KEGG   Helicobacter pylori PeCan4: HPPC_05610
Entry
HPPC_05610        CDS       T01322                                 

Name
(GenBank) signal recognition particle protein
  KO
K03106  signal recognition particle subunit SRP54 [EC:3.6.5.4]
Organism
hpc  Helicobacter pylori PeCan4
Pathway
hpc02024  Quorum sensing
hpc03060  Protein export
hpc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:hpc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    HPPC_05610
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    HPPC_05610
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    HPPC_05610
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpc02044]
    HPPC_05610
Enzymes [BR:hpc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.4  signal-recognition-particle GTPase
     HPPC_05610
Secretion system [BR:hpc02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   HPPC_05610
  Eukaryotic Sec-SRP protein
   HPPC_05610
SSDB
Motif
Pfam: SRP54 SRP_SPB CbiA SRP54_N AAA_31 Zeta_toxin AAA_30 AAA_22 AAA_24 AAA_17 DUF2075 AAA 6PF2K cobW APS_kinase ArsA_ATPase AAA_16 ResIII AAA_14 Fer4_NifH ABC_tran AAA_33 DO-GTPase1 NTPase_1 AAA_11 T2SSE Thymidylate_kin KTI12 AAA_19 ParA AAA_18 NACHT KdpD MraZ TsaE MobB ATP_bind_1 YqeC
Other DBs
NCBI-ProteinID: ADO07332
UniProt: E1Q384
Position
complement(1137490..1138836)
AA seq 448 aa
MFQALSDGFKNALNKIRFQDDEKALDRALDELKKTLLKNDVHHKVARELLKKVESQTKLN
GIGKQQFLDALEKSLLEILSAKGSSGFTFAQTPPTVVLMAGLQGSGKTTTTAKLAHYLKT
KNKKVLLCACDLQRLAAVEQLKVLGEQVGVEVFHEENKSVKEIANNALKRAKEAQFDVLL
VDSAGRLAIDKELMQELKEVKEVLNPHEVLYVADALSGQDGVKSANTFNEEIGVSGVVLS
KFDSDSKGGIALGITYQLGLPLRFIGSGEKIPDLDVFVPERIVGRLMGAGDIISLAEKTA
SVLNPNEAKDLSKKLKKGQFTFNDFLNQIEKVKKLGSMSSLISMIPGLGNMASALKDTDL
ESSLEVKKIKAMVNSMTKKEQENPEILNGSRRKRIALGSGLEVSEINRIIKRFDQASKMA
KRLTNKKGISDLMNLMSQAKNQTPPKMR
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgtttcaagcgttaagcgatgggtttaaaaacgcgctcaataaaatccgctttcaagat
gatgaaaaagcgctagacagagcgttagatgaattgaaaaaaacgcttttaaaaaatgat
gtgcatcataaagtggctagagaattgcttaaaaaagtggaaagccagactaaactcaat
ggcattggcaagcagcaatttttagacgctttagaaaagagtttgttagaaattttaagc
gctaaagggagcagtggtttcactttcgctcaaacgccccccaccgtggttttaatggcc
ggtttgcaagggagcggtaagacaaccaccaccgctaaactcgctcattatttaaaaacc
aaaaataaaaaagtgcttttatgcgcatgcgatttgcaacgcttagcggcggtggagcaa
ttaaaggttttgggcgaacaggtgggcgtggaagtgtttcatgaagaaaataaaagcgtg
aaagaaatcgccaacaacgctttaaaaagggctaaagaagcgcaatttgatgttttactt
gtggatagcgcggggcgtttagccattgataaagagcttatgcaagaattaaaagaagtc
aaagaagtcttaaacccccatgaagtgctgtatgttgcagacgcgttgagcgggcaagat
ggggtcaaaagcgcgaacacctttaatgaagaaataggcgtgagcggggtggtgttaagc
aaatttgatagcgattctaaagggggtatcgctttaggcatcacttaccaattaggctta
cccttgcgttttattgggagcggggaaaaaatccctgatttagatgtgtttgtgcctgaa
aggattgtggggcgtttgatgggggctggagatattatctcgctcgctgaaaaaaccgct
agcgttttaaaccctaatgaagccaaagatttaagcaaaaagctcaaaaaagggcaattc
actttcaatgactttttaaaccagattgaaaaagtgaaaaaattaggctctatgagttct
ctaatctctatgattccaggtttagggaatatggcaagcgcgctaaaagacacggattta
gaaagctctttagaagtgaaaaaaatcaaggctatggtcaattccatgaccaaaaaagag
caagaaaaccccgagattttaaacggcagccgaagaaaaaggatcgctttagggagcggc
ttagaagtgtctgaaatcaaccgcattatcaaacgctttgatcaggcgagcaaaatggcg
aaacgcttaacgaataaaaagggtattagcgatttgatgaatttaatgagtcaggctaaa
aatcaaacgccccctaaaatgcgctaa

DBGET integrated database retrieval system