KEGG   Helicobacter pylori PeCan4: HPPC_06170
Entry
HPPC_06170        CDS       T01322                                 

Symbol
secG
Name
(GenBank) preprotein translocase subunit SecG
  KO
K03075  preprotein translocase subunit SecG
Organism
hpc  Helicobacter pylori PeCan4
Pathway
hpc02024  Quorum sensing
hpc03060  Protein export
hpc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:hpc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    HPPC_06170 (secG)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    HPPC_06170 (secG)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    HPPC_06170 (secG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpc02044]
    HPPC_06170 (secG)
Secretion system [BR:hpc02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   HPPC_06170 (secG)
SSDB
Motif
Pfam: SecG BRINP
Other DBs
NCBI-ProteinID: ADO07442
UniProt: E1Q3L3
Position
1253479..1254105
AA seq 208 aa
MTSALLGLQIVLAVLIVVVVLLQKSSSIGLGAYSGSNDSLFGAKGPASFMAKLTMFLGLL
FVANTIALGYFYNKEYGKSILDETKTNKELSPLVPATGTLNPTLNPTLNPTLNPTLNPTL
NPLEQVPTNPLMPKQTPNELPKEPAKAPFIESPKQNEKNDANKENKENNIKGVEKTKENT
KTPPTAHQKPKTHATQTNAHTNQKKDEK
NT seq 627 nt   +upstreamnt  +downstreamnt
atgacaagcgctctgttaggcttacaaattgttttagcggtattgattgtggtggtggtt
ttgttgcaaaaaagttctagcatcggcttaggggcttatagcggaagcaacgattcttta
tttggcgctaaagggcctgcaagctttatggcgaaattgaccatgtttttagggctgtta
tttgttgccaacaccatcgctttgggctatttttacaacaaagaatacggcaaaagcatt
ttagatgaaactaaaaccaacaaagagctttcgccattagttcctgccaccggtacgctt
aacccaacgcttaacccaacgcttaatcccacactaaacccaacgctcaacccaacactc
aaccctttagagcaagttcccactaaccctttaatgcccaaacaaacgcctaacgaactt
cctaaagagccagccaaagcgccttttattgaaagccccaagcagaatgaaaaaaatgat
gccaataaagagaataaagagaacaatataaagggcgttgaaaaaaccaaagagaacaca
aaaacgcccccaaccgcccaccaaaagcctaaaacgcatgcaacacaaaccaacgcccat
acaaaccaaaaaaaggatgaaaaataa

DBGET integrated database retrieval system