KEGG   Helicobacter pylori PeCan4: HPPC_06395
Entry
HPPC_06395        CDS       T01322                                 

Symbol
secY
Name
(GenBank) preprotein translocase subunit SecY
  KO
K03076  preprotein translocase subunit SecY
Organism
hpc  Helicobacter pylori PeCan4
Pathway
hpc02024  Quorum sensing
hpc03060  Protein export
hpc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:hpc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    HPPC_06395 (secY)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    HPPC_06395 (secY)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    HPPC_06395 (secY)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpc02044]
    HPPC_06395 (secY)
Secretion system [BR:hpc02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   HPPC_06395 (secY)
SSDB
Motif
Pfam: SecY DUF485
Other DBs
NCBI-ProteinID: ADO07487
UniProt: E1Q3Q8
Position
complement(1291225..1292487)
AA seq 420 aa
MNKAIASKILITLGFLFLYRVLAYIPIPGVDLAAIKAFFDSNSNNALGLFNMFSGNAVSR
LSIISLGIMPYITSSIIMELLSATFPNLAKMKKERDGMQKYMQIVRYLTILITLIQAVSV
SVGLRSISGGVNGAIMIDMQVFMIVSAFSMLTGTMLLMWIGEQITQRGVGNGISLIIFAG
IVSGIPSAISGTFNLVNTGVINILMLIGIVLIVLATIFAIIYVELAERRIPISYARKVVM
QNQNKRIMNYIPIKLNLSGVIPPIFASALLVFPSTILQQATSNKTLQAIADFLSPQGYAY
NILMFLLIIFFAYFYSSIVFNSKDIADNLRRNGGYIPGLRPGEGTSSFLNSVASKLTLWG
SLYLALISTVPWILVKAMGVPFYFGGTAVLIVVQVAIDTMKKIEAQIYMSKYKTLSAVGF
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgaataaagctattgctagtaagatactcatcactttgggttttttatttctctacaga
gtcttagcttatatccccattcctggcgtagatttagcagcgatcaaggctttttttgac
agcaattccaacaacgctttggggttgtttaacatgtttagcgggaatgcggtttctcgc
ttgagcatcatctctttgggtatcatgccctatatcacttcttcaattatcatggagctt
ttgagcgcgactttccccaacctggctaaaatgaaaaaagagcgagacggcatgcaaaaa
tacatgcaaattgtgcgctatttgaccattttgatcaccctaatccaagcggtgagcgtt
tcagtgggcttaaggagcattagcgggggagtcaatggagcgatcatgattgatatgcaa
gtctttatgatcgtttcagcgttttctatgcttacagggacgatgctgctcatgtggata
ggggagcaaatcacgcaaaggggcgtggggaatgggatcagtctcattatttttgccggg
attgtttcagggatcccatcggctatttcaggcacattcaacttggtcaatacgggcgtt
attaatatcttaatgctcattggtattgtgctgattgttttagcgactatttttgcgatt
atctatgtggaattagccgagcgcaggattcctatttcttatgcgcgtaaagtggtgatg
caaaaccaaaacaagcgcatcatgaattacattcccattaagttgaatttaagcggggtg
atcccccctattttcgcttcagctttgctcgtgttcccttctacgattttgcagcaagcc
acaagcaacaaaaccttgcaagcgattgcggattttttaagcccgcaagggtatgcgtat
aatattttgatgttcttgctcattatcttttttgcttacttttattcttctatcgtgttc
aattctaaggatattgcggataatttaaggcgtaatggcgggtatattccagggcttagg
cctggggaggggacttcatcgtttttaaattctgtagcgagtaagctcactttgtggggt
tcattgtatttagcgctcatttctaccgtgccttggattttggttaaggctatgggcgtg
cctttttactttggaggcacggcggtgctgattgtggttcaggtcgctattgataccatg
aaaaagattgaagcgcaaatttatatgagcaagtataaaactttaagcgcggtaggcttt
taa

DBGET integrated database retrieval system