KEGG   Helicobacter pylori PeCan4: HPPC_07075
Entry
HPPC_07075        CDS       T01322                                 

Name
(GenBank) putative inner membrane protein translocase component YidC
  KO
K03217  YidC/Oxa1 family membrane protein insertase
Organism
hpc  Helicobacter pylori PeCan4
Pathway
hpc02024  Quorum sensing
hpc03060  Protein export
hpc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:hpc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    HPPC_07075
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    HPPC_07075
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    HPPC_07075
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hpc03029]
    HPPC_07075
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpc02044]
    HPPC_07075
Mitochondrial biogenesis [BR:hpc03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    HPPC_07075
Secretion system [BR:hpc02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   HPPC_07075
SSDB
Motif
Pfam: 60KD_IMP YidC_periplas
Other DBs
NCBI-ProteinID: ADO07623
UniProt: E1Q4J5
Position
1408146..1409792
AA seq 548 aa
MDKNNNNNLRLILAIALSFLFIALYSYFFQKPNKTTTQTTKQETTNNHTTTSPNAPNAQH
FSVTQTIPQENLLSTISFEHARIEIDSLGRIKQVYLKDKKYLTPKEKGFLEHVGHLFSSK
ENAQPPLKELPLLAADKLKPLEVRFLDPTLNNKAFNTPYSASKTTLGPNEQLVLTQDLGA
LTIIKTLTFYDDLHYDLKIAFKSPNNLIPSYVITNGYRPVADLDSYTFSGVLLENTDKKI
EKIEDKDAKEIKRFSNTLFLSSVDRYFTTLLFTKDSQGFEALIDSEIGTKNPLGFISLKN
EATLHGYIGPKDYRSLKAISPMLTDVIEYGLITFFAKGVFVLLDYLYQFVGNWGWAIILL
TIIVRLILYPLSYKGMVSMQKLKELAPKMKELQEKYKGEPQKLQAHMMQLYKKHGANPLG
GCLPLILQIPVFFAIYRVLYNAVELKSSEWILWIHDLSIMDPYFILPLLMGASMYWHQSV
TPNTMTDPMQAKIFKLLPLLFTIFLITFPAGLVLYWTTNNILSVLQQLIINKVLENKKRM
HAQNKKEH
NT seq 1647 nt   +upstreamnt  +downstreamnt
atggataaaaacaacaataataatctccgcttgattttagcgatcgctctgtctttcttg
tttatcgctctttatagctattttttccaaaaaccaaacaaaacaacaacccaaaccaca
aagcaagaaacaaccaacaaccacacaacaacaagtcctaacgcgcccaacgcccaacat
tttagcgttactcaaaccatcccccaagagaatttgttaagcacgatttcttttgagcat
gccaggattgaaattgattctttagggcgtatcaaacaggtttatctcaaggataaaaag
tatctaacccctaaagaaaagggctttttagagcatgtgggccatctttttagctccaaa
gaaaacgcgcaaccccccctaaaagagctcccccttttagcagccgataaactcaagcct
ttagaagtgcgttttttagaccccacactcaataacaaagcgttcaacaccccttatagc
gcttcaaaaaccactcttgggcctaacgaacagctcgttttaacccaagatttaggcgct
cttactatcattaaaaccctgactttctatgatgatttgcattatgatttaaaaatcgca
ttcaaatcgcctaataaccttatccctagctatgtcatcaccaatggttacaggccggtg
gctgatttggacagctacaccttttcaggcgtgcttttagaaaacaccgacaaaaaaatt
gaaaaaattgaagataaagacgccaaagaaatcaaacgcttttctaacaccctcttttta
tccagcgtggataggtatttcaccaccttgcttttcactaaagattctcaaggttttgaa
gccttaattgattcagaaatagggactaaaaaccccttagggttcatttctcttaaaaat
gaagcaactctgcatggttatattggccccaaagattaccgctctttgaaagcgatttcg
cccatgctcactgatgtgatagagtatggcttaatcactttctttgctaaaggcgtgttt
gttttactggattatttgtatcaatttgtgggcaattggggttgggctatcattctttta
acgattatcgtgcgcctaatcctttaccccttaagctataaaggcatggtgagcatgcaa
aagctcaaggaattagcccccaaaatgaaagagctccaagaaaaatacaagggcgaaccc
caaaaattgcaagcccacatgatgcagctttacaaaaaacatggggctaacccactaggg
ggttgtttgcccttaatcttacaaatcccagtgttttttgcgatttatagagtgctttat
aacgctgtggaattgaaaagctcagagtggatcttatggattcatgatttatccatcatg
gatccgtatttcattttaccgcttcttatgggagcgtctatgtattggcaccaaagcgtt
acgccaaacaccatgaccgatcccatgcaagcaaagatttttaaactcctacccctatta
ttcacgatctttttaatcactttccctgcagggttagtcttgtattggaccacaaacaac
atcctttcggtgttgcaacaactcatcattaataaagttttagagaataaaaaacgcatg
catgcgcaaaacaaaaaggaacattga

DBGET integrated database retrieval system