KEGG   Helicobacter pylori PeCan4: HPPC_07705
Entry
HPPC_07705        CDS       T01322                                 

Name
(GenBank) VirB8 type IV secretion protein
  KO
K03203  type IV secretion system protein VirB8
Organism
hpc  Helicobacter pylori PeCan4
Pathway
hpc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:hpc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    HPPC_07705
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpc02044]
    HPPC_07705
Secretion system [BR:hpc02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   HPPC_07705
SSDB
Motif
Pfam: VirB8 DUF5693
Other DBs
NCBI-ProteinID: ADO07745
UniProt: E1Q5C2
Position
1544901..1546070
AA seq 389 aa
MSKRSEVLEQFHGGLKNLELQTKRRMDLWGDLKENEEQTLLLEEIENELKQLENKEDLKA
DNNTGLKEENQDTKENYPNDLFSLPLPIQTTTNEIKEFVEEPVIETEEKETPQNESIQEE
KERIFKNFFSRIGFNKSIAPTMLFEEVRDASVIYHLEKKLGDYIFYVACFFFGTTVLLVI
LLIVLLPLKQKEPYLVQFSNNKENFALVQKADSTITANKALIRSLVGAYVLNRESITHIE
QHEKIRQNTIKEQSSNEVWYEFEKLIAYHDSIYTNPLLIRKVKIANIYLDKDLAYIDIEV
GLYHSGELESLKRYKVVMSFEFKKQEINFDSMSLNPTGFIVTGYDVTEIAILKDLDEKNK
VKDDGVKSRIIHTEKKDPHMSQYKDIKEQ
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgtcaaaaagaagcgaagttttagaacaatttcatggcggtttaaaaaatttagaatta
caaactaaaagacgcatggatttgtggggcgatctaaaagagaatgaagaacaaactttg
cttttagaagaaattgaaaatgaattaaaacaattagaaaataaagaagatcttaaagca
gacaataacacagggcttaaagaagaaaatcaagacactaaagaaaactatcctaacgac
ttgttttctttgccattacccattcaaaccaccaccaatgaaattaaagagtttgtagaa
gagcctgtgatagaaacagaagaaaaagaaacaccccaaaacgagtcaatccaagaagaa
aaagaaagaatttttaaaaactttttctccagaataggctttaataaaagtattgctccc
acaatgctctttgaagaagtgagagatgcaagcgttatctatcatttagagaaaaaatta
ggcgattatatattttatgtagcgtgtttcttctttggtacaacagtactgcttgttatc
ttactgatcgttctgttgccgttaaaacaaaaagagccgtatttagtgcaattttctaac
aataaagaaaattttgctttagttcaaaaggcagatagcaccattacagccaataaagct
cttattcgttcattagtgggagcgtatgtgctaaatagggaaagcattactcatattgaa
caacatgaaaaaatacgtcaaaacaccattaaagagcaaagttccaatgaggtatggtat
gaatttgaaaaactcatcgcttatcatgacagcatttacacgaatcctttacttataaga
aaggtaaagattgcaaatatctatttagataaagatttagcctatattgacattgaagtg
ggcttgtatcatagcggagaattagagagcttaaaacgctataaagtggtgatgagtttt
gaatttaaaaaacaagaaatcaattttgactccatgtctttaaaccctacaggctttatt
gttacaggttatgacgtaactgaaattgcgattttaaaagacttggatgagaaaaataaa
gtcaaagatgatggtgtgaaatctaggattatccataccgagaaaaaagaccctcacatg
agccaatataaagatattaaggagcaataa

DBGET integrated database retrieval system