KEGG   Helicobacter pylori PeCan4: HPPC_07755
Entry
HPPC_07755        CDS       T01322                                 

Name
(GenBank) conjugal transfer protein (traG)
  KO
K03205  type IV secretion system protein VirD4 [EC:7.4.2.8]
Organism
hpc  Helicobacter pylori PeCan4
Pathway
hpc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:hpc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    HPPC_07755
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpc02044]
    HPPC_07755
Enzymes [BR:hpc01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     HPPC_07755
Secretion system [BR:hpc02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   HPPC_07755
SSDB
Motif
Pfam: T4SS-DNA_transf TrwB_AAD_bind TraG-D_C DUF87
Other DBs
NCBI-ProteinID: ADO07755
UniProt: E1Q5D2
Position
1552006..1553754
AA seq 582 aa
MIEKFKTLRDKFKDKTSNLFHKLNSIQKDYYTKTLPKACKDVFTLGSSKSYPMTLNFNKG
FCVGLYKGLNSLKPTYYDAPLSTLIIAPPGSGKTAAVAVPNLLSVPSSCVVLDIKGELFD
LTAGYRQQVLKNKIFVFDPLGNDNTLKFNPFDKRTVEKLDFNRKRRLVDEVGNTIFAEDG
ANKDPHWTQQAKNLFVFYALYDLCVHNTSTFFEIASAPIKNYVPLINPQSRFYTELYECQ
SSDNGFVKENGRYMAKVENGVKKMKPNVNVELLWYKQVAEQVYTDPENPKNYDGSVNNLE
KDDQGNVIMKEGMLDPVIRNEANKWAKANDKEFASIKSVYSRFMQVFTSYQVKSATDSMS
FEYEDLRVDNISLYIKIAQTDIDTLAPLIRILLESIAKNLLLKESKKFEERVYLFLDEFV
RFGKLPFLLEMPALSRSYGVVLIFITQSNALIEKYYGREDARIVNSTVAYKVIFKMDDLE
YAKQVSEEVGKMTRKTRSHSTEKGQLITGGTSSIGKEAWDLLSAQDIMNIDKDEVIILVS
GHKAKPLKLKANYYFKNKELLSRINWEVKPNEEVFDESKKDV
NT seq 1749 nt   +upstreamnt  +downstreamnt
atgatagaaaaattcaaaacattaagagataaatttaaggataaaaccagcaatttattc
cataagcttaatagcattcaaaaagattattacactaaaactctccctaaggcttgcaaa
gatgtctttacgctaggttcttctaagagttatcctatgaccttaaattttaacaaaggt
ttttgtgtggggctatataaaggtttaaattcacttaagcctacttattatgatgctccg
ctttctactttaattatcgctcctcctggaagtggtaaaaccgcagctgtggctgtgcct
aatcttttaagcgtgcctagctcttgtgtggtgttagatattaaaggggagttgtttgat
ttaacggctggttacagacaacaagttctaaaaaataaaatttttgtatttgatccctta
ggaaatgataacacgcttaaattcaatccgtttgataaacgcactgtagaaaaattagat
tttaaccgaaagcgaaggcttgtagatgaagtgggtaatactatttttgctgaagatggg
gcaaataaagaccctcattggacacagcaagctaaaaatttatttgtcttttacgctctt
tatgatttgtgtgtgcataacactagcaccttttttgaaattgctagcgctcctataaaa
aattatgtccccttaatcaatccacaaagccgattttatactgaattatatgaatgtcaa
agtagtgataatggttttgttaaagagaatgggcgttatatggctaaagtagaaaatggc
gttaaaaaaatgaaacctaatgtcaatgtggaattgctatggtataaacaagtagccgaa
caagtctatactgacccagaaaatcctaaaaattatgatggatctgtgaataatttagaa
aaagacgatcaaggcaatgttataatgaaagagggcatgttagatcctgttattagaaac
gaagcgaacaaatgggctaaggcgaatgataaagagtttgcgagcattaaatcagtttat
agccgttttatgcaagtctttacaagctatcaagttaaaagcgctacagatagcatgagt
tttgaatacgaggatttaagggttgacaatatttcactctatattaaaatcgctcaaaca
gatattgacacactcgcaccgcttatccgtatccttttggaaagtattgctaaaaatctt
ttattgaaagagagtaagaaatttgaagaaagggtttatctgtttttagatgaatttgtg
cgttttggtaaattgccttttttattagaaatgcccgcattaagtaggagctatggtgtg
gttttaatttttatcacgcaatccaatgctcttattgaaaaatattatggtagagaagat
gcaagaattgttaatagcaccgtggcttacaaagtaattttcaaaatggatgatttagaa
tatgctaaacaagtgagcgaagaagtcggtaagatgactagaaaaacacgaagccactct
acagaaaaaggacaactcattaccggaggaacttctagtataggtaaagaggcgtgggac
ttattgagcgcgcaagatattatgaatattgataaagatgaagtgatcattttagtaagc
ggtcataaggctaaacccttaaaattaaaagcgaattattatttcaaaaacaaagaatta
ctctctcgtattaattgggaagtcaagcccaatgaagaagtgtttgatgaatcaaaaaag
gatgtatga

DBGET integrated database retrieval system