KEGG   Helicobacter pylori PeCan4: HPPC_07875
Entry
HPPC_07875        CDS       T01322                                 

Symbol
yajC
Name
(GenBank) preprotein translocase subunit YajC
  KO
K03210  preprotein translocase subunit YajC
Organism
hpc  Helicobacter pylori PeCan4
Pathway
hpc02024  Quorum sensing
hpc03060  Protein export
hpc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:hpc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    HPPC_07875 (yajC)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    HPPC_07875 (yajC)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    HPPC_07875 (yajC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpc02044]
    HPPC_07875 (yajC)
Secretion system [BR:hpc02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   HPPC_07875 (yajC)
SSDB
Motif
Pfam: YajC Orf78 DUF6249 Holin_BhlA TM1506
Other DBs
NCBI-ProteinID: ADO07773
UniProt: E1Q5F0
Position
1585113..1585406
AA seq 97 aa
MGQIKDILTTLLPFVVLFLIFYFLIVRPQRQQQKKHKEMIEGLTKGDKIVTQGGFIVEVL
KAEANFFSVKLNDDTTAKLSKNYVAFKLDEETTPNNN
NT seq 294 nt   +upstreamnt  +downstreamnt
atgggacaaattaaagacattctaacaacgcttttaccctttgtggtgttgtttcttatt
ttttattttttgattgttcgcccgcaacgccagcaacaaaaaaagcataaagaaatgata
gagggcttgactaagggcgataaaattgtcactcaaggagggttcatcgttgaggtgctt
aaagcggaagcgaatttttttagcgtgaaactcaatgatgacaccaccgctaaactttct
aaaaactatgtagcgttcaaattagacgaagaaacaacacccaacaacaactga

DBGET integrated database retrieval system