KEGG   Helicobacter pylori PeCan4: HPPC_07880
Entry
HPPC_07880        CDS       T01322                                 

Symbol
secD
Name
(GenBank) preprotein translocase subunit SecD
  KO
K03072  preprotein translocase subunit SecD
Organism
hpc  Helicobacter pylori PeCan4
Pathway
hpc03060  Protein export
hpc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:hpc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    HPPC_07880 (secD)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    HPPC_07880 (secD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpc02044]
    HPPC_07880 (secD)
Secretion system [BR:hpc02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   HPPC_07880 (secD)
SSDB
Motif
Pfam: SecD_SecF ACR_tran MMPL Sec_GG Haemagg_act
Other DBs
NCBI-ProteinID: ADO07774
UniProt: E1Q5F1
Position
1585407..1586984
AA seq 525 aa
MKLFNPRLIVFICALLLGVGFSVPSLLETKGPKITLGLDLRGGLNMLLGVQTDEALKNKY
LSLASALEYNAKKQNILLKDIKSSLEGISFELLDEDEAKKLDALLLELQGHSQFEIKKEA
EFYSVKLTPLEQEELRKNTILQVIGIIRNRLDQFGLAEPVVIQQGKEEISVQLPGIKTLE
EERRAKDLISRSAHLQMMAVDEEHNKDAMKMTDLEAQKLGSVLLSDVEMGGKILLKAIPI
LDGEMLTDAKVVYDQNNQPVVSFTLDAQGAKIFGDFSGANVGKRMAIVLDNKVYSAPVIR
ERIGGGSGQISGNFSVAQASDLAIALRSGAMSAPIQVLEKRIIGPSLGKDSIKTSIIALI
GGFILVMGFMVLYYSMAGVIACLALVVNLFLIVAVMAIFGATLTLPGMAGIVLTVGIAVD
ANIIINERIREVLRENEGIAKAIHLGYINASRAIFDSNTTSLIASVLLYAYGTGAIKGFA
LTTGIGILASIITAIIGTQGIYQALLPKLTQTKSLYFWFGVNKRA
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgaaactttttaaccctcgtttaatcgtttttatttgtgcgcttcttttaggggtaggg
ttttctgtgccttctttactagagactaaaggccctaaaatcactttaggtttggattta
aggggggggttaaacatgcttttaggggtgcaaaccgatgaggctttaaaaaacaagtat
ttaagcttggcgtccgctttagaatataacgctaaaaaacaaaatatcttgcttaaagac
attaaatccagcctagaagggatcagttttgagcttttagatgaagatgaagcgaaaaaa
ttagacgcgcttttattggaattgcaaggccatagccagtttgaaatcaaaaaagaagcg
gaattttatagcgtgaagctcacccctttagagcaagaagaattgcgtaaaaacacgatt
ttgcaagtgatagggatcatccgtaaccgcttggatcaatttggtttggcagagcctgta
gtcattcagcaaggtaaagaagaaatttcggtgcaattgcctggcattaagactttagaa
gaagaacggcgcgctaaagacttgatttcaagatccgctcatttgcagatgatggcggtg
gatgaagaacacaataaagatgcgatgaaaatgacggatttagaggctcaaaaattaggc
agcgtgttgttgtctgatgtggaaatggggggtaaaatcttactcaaagcgatccccatt
ttagatggcgaaatgcttacggatgcgaaggtggtgtatgatcaaaacaaccagccggtg
gtgagcttcacgctggatgcgcaaggggctaagatttttggggatttctcaggtgcgaat
gtgggcaaacgcatggcgattgttttagacaataaggtttattcagccccagtgatcagg
gagcgtattggcggagggagcgggcaaattagtgggaattttagcgtggctcaagcgagc
gatttagcgatcgctttaaggagtggggcgatgagcgctcccattcaggttttagaaaaa
aggattataggcccgagtttagggaaagacagcattaaaacttccattatcgctctgatt
gggggctttattttggttatgggttttatggtgctttattactctatggcgggggtgatc
gcttgtttggcgttagtggtcaatctttttttgattgtggcggtcatggcgatttttgga
gcgacgctgactttaccgggaatggcggggattgttttaaccgtggggattgccgtggat
gctaatatcattatcaatgagcgcattagagaagtcttaagagagaatgagggcatcgct
aaggcgatccatttaggctatatcaatgcgagtagagcgatttttgattccaataccact
tccttgatcgcttcggtgttgttatacgcttatggcacaggagcgattaaaggctttgct
ctcaccacaggcattgggattttagcctctatcatcaccgctattataggcacgcaaggg
atttatcaagcccttttacctaaactcactcaaacaaaaagcctttacttttggtttggc
gtgaataaaagagcttag

DBGET integrated database retrieval system