KEGG   Helicobacter pylori PeCan4: HPPC_07885
Entry
HPPC_07885        CDS       T01322                                 

Symbol
secF
Name
(GenBank) preprotein translocase subunit SecF
  KO
K03074  preprotein translocase subunit SecF
Organism
hpc  Helicobacter pylori PeCan4
Pathway
hpc03060  Protein export
hpc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:hpc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    HPPC_07885 (secF)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    HPPC_07885 (secF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpc02044]
    HPPC_07885 (secF)
Secretion system [BR:hpc02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   HPPC_07885 (secF)
SSDB
Motif
Pfam: SecD_SecF Sec_GG ACR_tran MMPL
Other DBs
NCBI-ProteinID: ADO07775
UniProt: E1Q5F2
Position
1586993..1587964
AA seq 323 aa
MELFKQTRILSFMRYSNYGVVVSAILVLLALGLLFFKGFSLGIDFAGGSLVQVRYTQNAP
IKEVRDLFEKEARFKGVQVSEFGSKEEILIKFPFVETAENEDLNAIVANILKPSGDFEIR
KFDTVGPRVGSELKEKGILSLILALIAIMVYVSFRYEWRFALASVIALVHDVILVASSVI
IFKIDMNLEVIAALLTLIGYSINDTIIIFDRIREEMLSQKTKNATQAIDEAISSTLTRTL
LTSLTVFFVVLILCVFGSKIIIGFSLPMLIGTIVGTYSSIFIAPKVALLLGFDMHKYYEN
EARKIKKAQEKEKMRRLYEGGQV
NT seq 972 nt   +upstreamnt  +downstreamnt
atggaattattcaaacaaactagaatcttaagcttcatgcgctattccaattatggggtg
gttgtttcagcgatcttggtgcttctggcgttggggcttttgtttttcaaagggttttct
ttagggattgattttgcgggggggagtttggtgcaggtgcgctacactcaaaacgctcct
attaaagaagtgcgcgatctttttgaaaaagaagctcgctttaaaggcgtgcaagtgagc
gaatttggctctaaagaagaaattttaatcaaattcccttttgtggaaacggctgaaaat
gaagacttgaacgctatcgtggcaaacattctaaaacccagcggcgattttgaaatccgt
aaatttgacaccgtgggccctagagtggggagcgagttgaaagaaaagggcattttgtcg
ctgattttagccttaatagcgatcatggtttatgtgagtttccgctatgaatggcgtttc
gctttagcgagcgttattgcacttgtgcatgacgtgattttagtggcaagctcggtgatc
atttttaagattgatatgaatctggaagtgattgcggctttgctcactttgattgggtat
tccattaatgatacgatcattatttttgatcggatcagagaagaaatgctctctcaaaaa
accaaaaatgccactcaagccattgatgaagccatttctagcacgctcacgcgcacgctt
ctaacttctttaaccgtgttttttgtggtgttgattttgtgcgtgtttgggagtaagatc
attattggcttttcattgcccatgttaataggcacgattgtagggacttatagttctatt
ttcatcgcccctaaagtagcgttattgttgggctttgatatgcataaatactatgaaaat
gaggctagaaaaatcaaaaaagctcaagagaaagaaaaaatgcgccgtttgtatgagggc
ggtcaagtttaa

DBGET integrated database retrieval system