KEGG   Homo sapiens (human): 100310812
Entry
100310812         CDS       T01001                                 
Symbol
SPDYE2B, SPDYE2L
Name
(RefSeq) speedy/RINGO cell cycle regulator family member E2B
  KO
K08694  speedy
Organism
hsa  Homo sapiens (human)
Pathway
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100310812 (SPDYE2B)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100310812 (SPDYE2B)
SSDB
Motif
Pfam: Spy1
Other DBs
NCBI-GeneID: 100310812
NCBI-ProteinID: NP_001159811
HGNC: 48334
Ensembl: ENSG00000173678
Pharos: A6NHP3(Tdark)
UniProt: A6NHP3
Position
7:102650319..102662625
AA seq 402 aa
MDRTETRFRKRGQITGKITTSRQPHPQNEQSPQRSTSGYPLQEVVDDEMLGPSAPGVDPS
PPCRSLGWKRKREWSDESEEEPEKELAPEPEETWVVEMLCGLKMKLKQQRVSSILPEHHK
DFNSQLAPGVDPSPPHRSFCWKRKMEWWDESEESLEEEPRKVLAPEPEEIWVAEMLCGLK
MKLKRRRVSLVLPEHHEAFNRLLEDPVIKRFLAWDKDLRVSDKYLLAMVIAYFSRAGFPS
WQYQRIHFFLALYLANDMEEDDEDSKQNIFHFLYRKNRSRIPLLRKPWFQLGHSMNPRAR
KNRSRIPLLRKRRFQLYRSTNPRARKNRSRIPLLRKRRFQLYRSMNSRARKNRSQIVLFQ
KRRFHFFCSMSCRAWVSPEELEEIQAYDPEHWVWARDRAHLS
NT seq 1209 nt   +upstreamnt  +downstreamnt
atggacagaacggagactaggttccgtaagaggggacagattacgggaaagatcacgacc
agccgtcaaccgcacccccagaatgagcagagtccccagcggagcacctcggggtacccc
ctccaggaggtggtggatgatgaaatgttgggaccatcagcccctggggtagatcccagc
cccccatgtaggtcccttggctggaaaaggaagagggagtggtcagatgaatctgaggag
gagccggagaaggagctcgcccctgagcctgaggagacctgggtagtggagatgctgtgt
gggctcaagatgaagctgaagcaacagcgagtgtcatccatcctccctgagcaccacaag
gacttcaacagtcagcttgcccctggggtagatcccagccccccgcataggtccttttgc
tggaaaaggaagatggagtggtgggacgaatctgaggagtcgttggaggaggagccacgg
aaggtgctcgcccctgagcctgaggagatctgggtggcggagatgctgtgtggcctcaag
atgaagctgaagcgacggcgagtgtcgctcgtgctccctgagcaccacgaggccttcaac
aggctgcttgaggatcctgtcattaaaagattcttggcctgggacaaagatctgagggtg
tcggacaagtatctcctggctatggtcatagcgtatttcagccgggccggcttcccctcc
tggcaataccaacgcattcatttcttcctggctctctacctggccaatgacatggaggag
gacgacgaggactccaaacaaaacatcttccacttcctgtataggaagaaccgctctcgc
atacccttgctccgtaagccttggttccagttaggccattccatgaacccgagggccagg
aagaaccgctctcgcatacccttgctccgtaagcgtcggttccagttataccgttccacg
aacccgagggccaggaagaaccgctctcgcatacccttgctccgtaagcgtcggttccag
ttataccgttccatgaactcgagggccaggaagaaccgctctcagatagtcctgttccag
aaacgacggttccacttcttctgttccatgagctgcagggcttgggtttccccagaggag
ttggaggagatccaggcttatgacccagagcactgggtgtgggcgcgagatcgcgctcac
ctttcctag

KEGG   Homo sapiens (human): 100505767
Entry
100505767         CDS       T01001                                 
Symbol
SPDYE18
Name
(RefSeq) speedy/RINGO cell cycle regulator family member E18
  KO
K08694  speedy
Organism
hsa  Homo sapiens (human)
Pathway
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100505767 (SPDYE18)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100505767 (SPDYE18)
SSDB
Motif
Pfam: Spy1
Other DBs
NCBI-GeneID: 100505767
NCBI-ProteinID: NP_001338277
HGNC: 51514
Ensembl: ENSG00000205482
Position
7:complement(77050391..77062558)
AA seq 275 aa
MDRTKTRFRKRGQITGKITTSRQPHPQNEQSLQRSTSGYPLQEVVDDEVLGPSAPGVDPS
PPCRSLGWKRKKEWSDESEEEPEKELAPEPEETWVVEMLCGLKMKLKQQRVSPILPEHHK
DFNSQLEDPVIKRFLAWDKDLRVSDKYLLAMVIAYFSRAGLPSWQYQRIHFFLALYLAND
MEEDDEDPKQNIFYFLYGKTRSRIPLVRNRRFQLCRCLNPRARKNRSQIALFQKLRFQFF
CSMSGRAWVSREELEEIQAYDPEHWVWARDRARLS
NT seq 828 nt   +upstreamnt  +downstreamnt
atggacagaacgaagactaggttccgtaagaggggacagattacgggaaagatcacgacc
agccgtcaaccgcacccccagaatgagcagagtctccagcggagcacctcggggtacccc
ctccaggaggtggtggatgatgaagtgttgggaccatcagcccctggggtagatcccagc
cccccatgtaggtcccttggctggaaaaggaagaaggagtggtcagatgaatctgaggag
gagccggagaaggagctcgcccctgagcctgaggagacctgggtagtggagatgctgtgt
gggctcaagatgaagctgaagcaacagcgagtgtcacccatcctccctgagcaccacaag
gacttcaacagtcagcttgaggatcctgtcattaaaagattcctggcctgggacaaagat
ctgagggtgtcggacaagtatctcctggctatggtcatagcgtatttcagccgggccggc
ctcccctcctggcaataccaacgcattcatttcttcctggctctctacctggccaatgac
atggaggaggacgacgaggaccccaaacaaaacatcttctacttcctgtatgggaagacc
cgctctcgcatacccttggtccgtaaccgtcggttccagttatgccgttgcttgaacccg
agggccaggaagaaccgctctcagatagccctgttccagaaacttcggttccagttcttc
tgttccatgagcggcagggcttgggtttcccgggaggagttggaggagatccaggcttat
gacccagagcactgggtgtgggcgcgagatcgcgctcgcctttcctag

KEGG   Homo sapiens (human): 100996746
Entry
100996746         CDS       T01001                                 
Symbol
SPDYE11
Name
(RefSeq) speedy/RINGO cell cycle regulator family member E11
  KO
K08694  speedy
Organism
hsa  Homo sapiens (human)
Pathway
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100996746 (SPDYE11)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100996746 (SPDYE11)
SSDB
Motif
Pfam: Spy1
Other DBs
NCBI-GeneID: 100996746
NCBI-ProteinID: NP_001338278
HGNC: 51507
Ensembl: ENSG00000275976
UniProt: P0DTA3
Position
7:complement(73047862..73057911)
AA seq 265 aa
MGQILGKIMMSHQPQPQEERSPQRSTSGYPLQEVVDDEVSGPSAPGVDPSPPRRSLGWKR
KRECLDESDDEPEKELAPEPEETWVAETLCGLKMKAKRRRVSLVLPEYYEAFNRLLEDPV
IKRLLAWDKDLRVSDKYLLAMVIAYFSRAGLPSWQYQRIHFFLALYLANDMEEDDEAPKQ
NIFYFLYEETRSHIPLLSELWFQLCRYMNPRARKNCSQIALFRKYRFHFFCSMRCRAWVS
LEELEEIQAYDPEHWVWARDRAHLS
NT seq 798 nt   +upstreamnt  +downstreamnt
atgggacagattttgggaaagatcatgatgagccatcaaccgcagccccaggaagagcgg
agcccccagcggagcacctcagggtaccccctccaggaggtggtggatgatgaagtgtcg
ggaccatcagcccctggggtagatcccagccccccacgtaggtcccttggctggaaaagg
aagagggaatgtttggatgaatctgatgatgagccagagaaggagctcgcccctgagcct
gaggagacctgggtggcggagacgctgtgtggcctcaagatgaaggcgaagcgacggcga
gtgtcgctcgtgctccctgagtactacgaggccttcaacaggctgcttgaggatcctgtc
attaaaagactcctggcctgggacaaagatctgagggtgtcggacaagtatctcctggct
atggtcatagcgtatttcagccgggccggcctcccctcctggcaataccaacgcattcat
ttcttcctggctctctatctggccaatgacatggaggaggacgacgaggcccccaaacaa
aacatcttctacttcctgtacgaggagacccgctctcatatacccttgctcagtgagctt
tggttccagttatgccgttacatgaacccgagggccaggaagaactgctctcagatagcc
ttgttccggaagtatcggttccacttcttttgttccatgcgctgcagggcttgggtttcc
ctggaggagttggaagagatccaggcttatgacccagagcactgggtgtgggcgcgagat
cgcgcccacctttcctag

KEGG   Homo sapiens (human): 102723555
Entry
102723555         CDS       T01001                                 
Symbol
SPDYE16
Name
(RefSeq) speedy/RINGO cell cycle regulator family member E16
  KO
K08694  speedy
Organism
hsa  Homo sapiens (human)
Pathway
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102723555 (SPDYE16)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    102723555 (SPDYE16)
SSDB
Motif
Pfam: Spy1
Other DBs
NCBI-GeneID: 102723555
NCBI-ProteinID: NP_001338526
HGNC: 51512
Ensembl: ENSG00000185040
Pharos: A6NNV3(Tdark)
Position
7:complement(76531313..76543297)
AA seq 312 aa
MQKHYTVAWFLYSAPGVDPSPPCRSLGWKRKKEWSDESEEEPEKELAPEPEETWVVEMLC
GLKMKLKQQRVSPILPEHHKDFNSQLAPGVDPSPPHRSFCWKRKREWWDESEESLEEEPR
KVLAPEPEEIWVVEMLCGLKMKLKRRRVSLVLPEHHEAFNRLLEDPVIKRFLAWDKDLRV
SDKYLLAMVIAYFSRAGLPSWQYQRIHFFLALYLANDMEEDDEDPKQNIFYFLYGKTRSR
IPLVRNRRFQLCRCMNPRARKNRSQIALFQKLRFQFFCSMSGRAWVSREELEEIQAYDPE
HWVWARDRARLS
NT seq 939 nt   +upstreamnt  +downstreamnt
atgcagaagcattacacggtggcctggtttctttactcagcccctggggtagatcccagc
cccccatgtaggtcccttggctggaaaaggaagaaggagtggtcagatgaatctgaggag
gagccggagaaggagctcgcccctgagcctgaggagacctgggtagtggagatgctgtgt
gggctcaagatgaagctgaagcaacagcgagtgtcacccatcctccctgagcaccacaag
gacttcaacagtcagcttgcccctggggtagatcccagccccccgcataggtccttttgc
tggaaaaggaagagggagtggtgggacgaatctgaggagtcgttggaggaggagccacgg
aaggtgctcgcccctgagcctgaggagatctgggtggtggagatgctgtgtggcctcaag
atgaagctgaagcgacggcgagtgtcgctcgtgctccctgagcaccacgaggccttcaac
aggctgcttgaggatcctgtcattaaaagattcctggcctgggacaaagatctgagggtg
tcggacaagtatctcctggctatggtcatagcgtatttcagccgggccggcctcccctcc
tggcaataccaacgcattcatttcttcctggctctctacctggccaatgacatggaggag
gacgacgaggaccccaaacaaaacatcttctacttcctgtatgggaagacccgctctcgc
atacccttggtccgtaaccgtcggttccagttatgccgttgcatgaacccgagggccagg
aagaaccgctctcagatagccctgttccagaaacttcggttccagttcttctgttccatg
agcggcagggcttgggtttcccgggaggagttggaggagatccaggcttatgacccagag
cactgggtgtgggcgcgagatcgcgctcgcctttcctag

KEGG   Homo sapiens (human): 102723849
Entry
102723849         CDS       T01001                                 
Symbol
SPDYE17
Name
(RefSeq) speedy/RINGO cell cycle regulator family member E17
  KO
K08694  speedy
Organism
hsa  Homo sapiens (human)
Pathway
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102723849 (SPDYE17)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    102723849 (SPDYE17)
SSDB
Motif
Pfam: Spy1
Other DBs
NCBI-GeneID: 102723849
NCBI-ProteinID: NP_001338280
HGNC: 51513
Ensembl: ENSG00000186645
UniProt: P0DUD2
Position
7:complement(77022306..77032361)
AA seq 265 aa
MGQILGKIMMSHQPQPQEERSPQRSTSGYPLQEVVDDEVSGPSAPGVDPSPPRRSLGWKR
KRECLDESDDEPEKELAPEPEETWVAETLCGLKMKAKRRRVSLVLPEYYEAFNRLLEDPV
IKRLLAWDKDLRVSDKYLLAMVIAYFSRAGLPSWQYQRIHFFLALYLANDMEEDDEAPKQ
NIFYFLYEETRSHIPLLSELWFQLCRYMNPRARKNCSQIALFRKYRFHFFCSMRCRAWVS
LEELEEIQAYDPEHWVWARDRAHLS
NT seq 798 nt   +upstreamnt  +downstreamnt
atgggacagattttgggaaagatcatgatgagccatcaaccgcagccccaggaagagcgg
agcccccagcggagcacctcagggtaccccctccaggaggtggtggatgatgaagtgtcg
ggaccatcagcccctggggtagatcccagccccccacgtaggtcccttggctggaaaagg
aagagggaatgtttggatgaatctgatgatgagccagagaaggagctcgcccctgagcct
gaggagacctgggtggcggagacgctgtgtggcctcaagatgaaggcgaagcgacggcga
gtgtcgctcgtgctccctgagtactacgaggccttcaacaggctgcttgaggatcctgtc
attaaaagactcctggcctgggacaaagatctgagggtgtcggacaagtatctcctggct
atggtcatagcgtatttcagccgggccggcctcccctcctggcaataccaacgcattcat
ttcttcctggctctctatctggccaatgacatggaggaggacgacgaggcccccaaacaa
aacatcttctacttcctgtacgaggagacccgctctcatatacccttgctcagtgagctt
tggttccagttatgccgttacatgaacccgagggccaggaagaactgctctcagatagcc
ttgttccggaagtatcggttccacttcttttgttccatgcgctgcagggcttgggtttcc
ctggaggagttggaagagatccaggcttatgacccagagcactgggtgtgggcgcgagat
cgcgcccacctttcctag

KEGG   Homo sapiens (human): 105180391
Entry
105180391         CDS       T01001                                 
Symbol
SPDYE15, SPDYE15P
Name
(RefSeq) speedy/RINGO cell cycle regulator family member E15
  KO
K08694  speedy
Organism
hsa  Homo sapiens (human)
Pathway
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    105180391 (SPDYE15)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    105180391 (SPDYE15)
SSDB
Motif
Pfam: Spy1
Other DBs
NCBI-GeneID: 105180391
NCBI-ProteinID: NP_001369476
HGNC: 51511
Ensembl: ENSG00000286014
Position
7:75335343..75347701
AA seq 265 aa
MGQILGKIMMSHQPQPQEERSPQRSTSGYPLQEVVDDEVLGPSAPGVDPSPPRRSLGWKR
KRECLDESDDEPEKELAPEPEETWVAETLCGLKMKAKRRRVSLVLPEYYEAFNRLLEDPV
IKRLLAWDKDLRVSDKYLLAMVIAYFSRAGLPSWQYQRIHFFLALYLANDMEEDDEAPKQ
NIFYFLYEETRSHIPLLSELWFQLCRYMNPRARKNCSQIALFRKYRFHFFCSMRCRAWVS
LEELEEIQAYDPEHWVWARDRAHLS
NT seq 798 nt   +upstreamnt  +downstreamnt
atgggacagattttgggaaagatcatgatgagccatcaaccgcagccccaggaagagcgg
agcccccagcggagcacctcagggtaccccctccaggaggtggtggatgatgaagtgttg
ggaccatcagcccctggggtagatcccagccccccacgtaggtcccttggctggaaaagg
aagagggaatgtttggatgaatctgatgatgagccagagaaggagctcgcccctgagcct
gaggagacctgggtggcggagacgctgtgtggcctcaagatgaaggcgaagcgacggcga
gtgtcgctcgtgctccctgagtactacgaggccttcaacaggctgcttgaggatcctgtc
attaaaagactcctggcctgggacaaagatctgagggtgtcggacaagtatctcctggct
atggtcatagcgtatttcagccgggccggcctcccctcctggcaataccaacgcattcat
ttcttcctggctctctatctggccaatgacatggaggaggacgacgaggcccccaaacaa
aacatcttctacttcctgtacgaggagacccgctctcatatacccttgctcagtgagctt
tggttccagttatgccgttacatgaacccgagggccaggaagaactgctctcagatagcc
ttgttccggaagtatcggttccacttcttttgttccatgcgctgcagggcttgggtttcc
ctggaggagttggaagagatccaggcttatgacccagagcactgggtgtgggcgcgagat
cgcgcccacctttcctag

KEGG   Homo sapiens (human): 245711
Entry
245711            CDS       T01001                                 
Symbol
SPDYA, RINGO3, RINGOA, SPDY1, SPY1
Name
(RefSeq) speedy/RINGO cell cycle regulator family member A
  KO
K08694  speedy
Organism
hsa  Homo sapiens (human)
Pathway
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    245711 (SPDYA)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    245711 (SPDYA)
SSDB
Motif
Pfam: Spy1 MCAfunc
Other DBs
NCBI-GeneID: 245711
NCBI-ProteinID: NP_001136106
OMIM: 614029
HGNC: 30613
Ensembl: ENSG00000163806
Pharos: Q5MJ70(Tbio)
UniProt: Q5MJ70 A0A384MTT5
Structure
Position
2:28810834..28850610
AA seq 313 aa
MRHNQMCCETPPTVTVYVKSGSNRSHQPKKPITLKRPICKDNWQAFEKNTHNNNKSKRPK
GPCLVIQRQDMTAFFKLFDDDLIQDFLWMDCCCKIADKYLLAMTFVYFKRAKFTISEHTR
INFFIALYLANTVEEDEEETKYEIFPWALGKNWRKLFPNFLKLRDQLWDRIDYRAIVSRR
CCEEVMAIAPTHYIWQRERSVHHSGAVRNYNRDEVQLPRGPSATPVDCSLCGKKRRYVRL
GLSSSSSLSSHTAGVTEKHSQDSYNSLSMDIIGDPSQAYTGSEVVNDHQSNKGKKTNFLK
KDKSMEWFTGSEE
NT seq 942 nt   +upstreamnt  +downstreamnt
atgaggcacaatcagatgtgttgtgagacaccacctactgtcactgtttatgtaaaatca
gggtcaaatagatcacatcagcctaaaaagcccattactctgaagcgtcctatttgtaaa
gataattggcaagcatttgaaaaaaatacacataataacaacaaatctaaacgccccaaa
ggaccttgtctggttatacagcgtcaggatatgactgctttctttaaattatttgatgac
gatttaattcaagatttcttgtggatggactgctgctgtaaaattgcagacaagtatctt
ttggctatgacctttgtttatttcaagagggctaaatttactataagtgagcataccagg
ataaatttctttattgctctgtatctggctaatacagttgaagaagatgaagaagaaacc
aagtacgaaatttttccatgggctttagggaaaaactggagaaaattgttccctaatttc
ttaaagttaagggaccagctctgggatagaattgactatagggctattgtaagcaggcga
tgttgtgaggaggttatggccattgcaccaacccattatatctggcaaagagaacgttct
gttcatcacagtggagctgtcagaaactacaacagagatgaagttcagctgccccgggga
cctagtgccacaccagtagattgttcactctgtggtaaaaaaagaagatatgttagactg
ggattgtcttcatcatcatctttatccagtcatacagcaggggtgacagaaaaacattct
caggactcatacaactcactgtcaatggacataataggtgatccttctcaagcttatact
ggttctgaagtagtcaatgaccatcaatcaaataaaggaaagaaaactaatttcttgaag
aaagacaaatctatggagtggtttacaggaagtgaagaatga

KEGG   Homo sapiens (human): 285955
Entry
285955            CDS       T01001                                 
Symbol
SPDYE1, Ringo1, SPDYB2L2, SPDYE, WBSCR19
Name
(RefSeq) speedy/RINGO cell cycle regulator family member E1
  KO
K08694  speedy
Organism
hsa  Homo sapiens (human)
Pathway
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
Disease
H01439  Williams-Beuren syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    285955 (SPDYE1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    285955 (SPDYE1)
SSDB
Motif
Pfam: Spy1
Other DBs
NCBI-GeneID: 285955
NCBI-ProteinID: NP_778234
OMIM: 617623
HGNC: 16408
Ensembl: ENSG00000136206
Pharos: Q8NFV5(Tdark)
UniProt: Q8NFV5
Position
7:43997897..44010124
AA seq 336 aa
MQKHYTVAWFLYSAPGVDPSPPCRSLGWKRKREWSDESEEEPEKELAPEPEETWVVETLC
GLKMKLKQQRVSPILLEHHKDFNSQLAPGVDPSPPHRSFCWKRKMEWWDKSEESEEEPRK
VLAPEPEEIWVAEMLCGLKMKLKRRRVSLVLPEHHEAFNRLLEDPVIKRFLAWDKDLRVS
DKYLLAMVIAYFSRAGFPSWQYQRLHFFLALYLANDMEEDDEDSKQNIFHFLYGKNRSRI
PLLRKRRFQLYRSMNPRARKNRSHIPLVRKRRFQLRRCMNPRARKNRSQIVLFQKRRFHF
FCSMSCRAWVSPEELEEIQAYDPEHWVWARDRARLS
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgcagaagcattacacagtggcctggtttctttactcagcccctggggtagatcccagc
cccccatgtaggtcccttggctggaaaaggaagagggagtggtcagatgaatctgaggag
gagccggagaaggagctcgcccctgagcctgaggagacctgggtagtggagacgctgtgt
gggctcaagatgaagctgaagcaacagcgagtgtcacccatcctccttgagcaccacaag
gacttcaacagtcagcttgcccctggggtagatcccagccccccgcataggtccttttgc
tggaaaaggaagatggagtggtgggacaaatctgaggagtcggaggaggagccacggaag
gtgctcgcccctgagcctgaggagatctgggtggcggagatgctgtgtggcctcaagatg
aagctgaagcgacggcgagtgtcgctcgtgctccctgagcaccacgaggccttcaacagg
ctgcttgaggatcctgtcattaaaagattcctggcctgggacaaagatctgagggtgtcg
gacaagtatctccttgctatggtcatagcgtatttcagccgagccggcttcccctcctgg
caataccaacgccttcatttcttcctggctctctacctggccaatgacatggaggaggac
gacgaggactccaaacaaaacatcttccacttcctgtatgggaagaaccgctctcgcata
cccttgctccgtaagcgtcggttccagttataccgttccatgaacccgagggccaggaag
aaccgctctcacatacccttggtccgtaagcgtcggttccagttacgccgttgcatgaac
ccgagggccaggaagaaccgctctcagatagtcctgttccagaaacgtcggttccacttc
ttctgttccatgagctgcagggcttgggtttccccagaggagttggaggagatccaggct
tatgacccagagcactgggtgtgggcgcgagatcgcgctcgcctttcctag

KEGG   Homo sapiens (human): 387778
Entry
387778            CDS       T01001                                 
Symbol
SPDYC, RINGOC, Ringo2, SPDYE4
Name
(RefSeq) speedy/RINGO cell cycle regulator family member C
  KO
K08694  speedy
Organism
hsa  Homo sapiens (human)
Pathway
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    387778 (SPDYC)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    387778 (SPDYC)
SSDB
Motif
Pfam: Spy1 MCAfunc
Other DBs
NCBI-GeneID: 387778
NCBI-ProteinID: NP_001008778
OMIM: 614030
HGNC: 32681
Ensembl: ENSG00000204710
Pharos: Q5MJ68(Tdark)
UniProt: Q5MJ68
Position
11:65170233..65173374
AA seq 274 aa
MSDSQDPTTSPVVTTQVELGGCSRQGGGNGFLRFRQHQEVQAFLSLLEDSFVQEFLSKDP
CFQISDKYLLAMVLVYFQRAHLKLSEYTHSSLFLALYLANDMEEDLEGPKCEIFPWALGK
DWCLRVGKFLHQRDKLWARMGFRAVVSRQCCEEVMAKEPFHWAWTRDRRPHHGGVQRVCP
QVPVRLPRGPGLSPPHCSPCGLPQHCSSHLLKPVSSKCPSLTSECHRPPSQNYLSRVKNA
WGGDFLIVLPPQMQLEPGTYSLRIFPKPPARPGH
NT seq 825 nt   +upstreamnt  +downstreamnt
atgagtgactcccaagaccccaccacttcccctgtagttaccacccaggtagagctgggg
ggctgcagccggcaaggtgggggcaatgggttcctccgttttcgccagcaccaggaggtc
caggccttcctcagccttctggaggacagttttgtccaggaattcctctccaaagacccc
tgcttccagatttcagataagtatctcctggccatggtgctggtctacttccagcgcgcc
cacctgaagctcagcgagtatacccacagcagcctgttcttggccctgtaccttgcaaac
gacatggaggaggacctggagggccccaaatgtgagatttttccatgggccctgggaaaa
gattggtgtttacgagtggggaaattcctgcaccagagggataagctttgggcacggatg
ggtttccgggctgttgtgagccgccagtgctgtgaggaggtcatggcaaaggagccattc
cactgggcttggactcgggaccggcgcccccaccatggtggggttcagagggtctgtcca
caggtccctgttcgccttccccggggccctggcctctcgccgccccactgttccccctgt
ggtttgccccagcactgcagcagccacttgcttaagcctgtgtcatccaagtgcccttct
ctgacctctgaatgtcatcgccctccctcccaaaattatctctcaagggtcaaaaacgcc
tggggtggggactttctcatcgtcttgcctccccagatgcaactggaaccaggcacctac
tccctccgcatcttcccaaagcctccggcacgccctgggcactga

KEGG   Homo sapiens (human): 388333
Entry
388333            CDS       T01001                                 
Symbol
SPDYE4
Name
(RefSeq) speedy/RINGO cell cycle regulator family member E4
  KO
K08694  speedy
Organism
hsa  Homo sapiens (human)
Pathway
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    388333 (SPDYE4)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    388333 (SPDYE4)
SSDB
Motif
Pfam: Spy1
Other DBs
NCBI-GeneID: 388333
NCBI-ProteinID: NP_001121548
OMIM: 617628
HGNC: 35463
Ensembl: ENSG00000183318
Pharos: A6NLX3(Tdark)
UniProt: A6NLX3
Position
17:complement(8747532..8758546)
AA seq 237 aa
MASGQARPPFEEESPQPSTTVRSPEVVVDDEVPGPSAPWIDPSPQPQSLGLKRKSEWSDE
SEEELEEELELERAPEPEDTWVVETLCGLKMKLKRKRASSVLPEHHEAFNRLLGDPVVQK
FLAWDKDLRVSDKYLLAMVIAYFSRAGLFSWQYQRIHFFLALYLASDMEEDNQAPKQDIF
SFLYGKNYSQRPLFHKLRYQLLCSMRWRTWVSPEEMEEIQAYDPEHWVWARDRTLIS
NT seq 714 nt   +upstreamnt  +downstreamnt
atggccagtggtcaagcgcgccccccgtttgaggaggagagcccccagcctagcacaacg
gtacggtcccccgaggtggtggtggatgatgaagtgccaggaccatcagccccttggata
gatcccagcccccagcctcaatcccttggcctgaaaaggaagagcgaatggtcagacgaa
tccgaggaggagctggaggaggagctggagttggagcgcgcccctgagcccgaggacacc
tgggtggtggagacgctgtgtgggctcaagatgaagctgaagcgaaagcgagcatcctcc
gtgctccctgagcaccacgaggccttcaacaggctccttggggatcctgtcgttcaaaaa
ttcctggcctgggacaaagacctgagggtgtcagacaagtatctcctggctatggtcata
gcgtattttagccgtgccggcctcttctcgtggcaataccaacgcattcatttcttcctg
gctctctacctggccagtgacatggaggaggacaaccaggccccgaaacaagacatcttc
tccttcctctacgggaagaactactcccagcgacccttgttccataagcttcgataccag
ctcctctgttccatgcgctggaggacgtgggtttccccagaggagatggaggagatccag
gcttatgacccagagcactgggtgtgggcccgagatcgcaccctcatttcctag

DBGET integrated database retrieval system