KEGG   Homo sapiens (human): 10061
Entry
10061             CDS       T01001                                 

Gene name
ABCF2, ABC28, EST133090, HUSSY-18, HUSSY18
Definition
(RefSeq) ATP binding cassette subfamily F member 2
  KO
K06185  ATP-binding cassette, subfamily F, member 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa05130  Pathogenic Escherichia coli infection
Network
nt06131  Apoptosis (viruses and bacteria)
  Element
N00939  Escherichia EspF to intrinsic apoptotic pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    10061 (ABCF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hsa03009]
    10061 (ABCF2)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    10061 (ABCF2)
SSDB
Motif
Pfam: ABC_tran ABC_tran_Xtn AAA_21 SMC_N AAA_29 RsgA_GTPase MMR_HSR1 AAA_33 AAA_24 AAA_16 AAA_22 AAA_14 AAA_28 AAA_18 AAA_15 VirE AAA_23 AAA_30 RNA_helicase Dynamin_N MukB FAM222A Rop
Other DBs
NCBI-GeneID: 10061
NCBI-ProteinID: NP_009120
OMIM: 612510
HGNC: 71
Ensembl: ENSG00000033050
Vega: OTTHUMG00000154570
Pharos: Q9UG63(Tbio)
UniProt: Q9UG63 A0A090N7X1
Position
7q36.1
AA seq 623 aa
MPSDLAKKKAAKKKEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKEL
EDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLN
GIGKSMLLSAIGKREVPIPEHIDIYHLTREMPPSDKTPLHCVMEVDTERAMLEKEAERLA
HEDAECEKLMELYERLEELDADKAEMRASRILHGLGFTPAMQRKKLKDFSGGWRMRVALA
RALFIRPFMLLLDEPTNHLDLDACVWLEEELKTFKRILVLVSHSQDFLNGVCTNIIHMHN
KKLKYYTGNYDQYVKTRLELEENQMKRFHWEQDQIAHMKNYIARFGHGSAKLARQAQSKE
KTLQKMMASGLTERVVSDKTLSFYFPPCGKIPPPVIMVQNVSFKYTKDGPCIYNNLEFGI
DLDTRVALVGPNGAGKSTLLKLLTGELLPTDGMIRKHSHVKIGRYHQHLQEQLDLDLSPL
EYMMKCYPEIKEKEEMRKIIGRYGLTGKQQVSPIRNLSDGQKCRVCLAWLAWQNPHMLFL
DEPTNHLDIETIDALADAINEFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWPGDILA
YKEHLKSKLVDEEPQLTKRTHNV
NT seq 1872 nt   +upstreamnt  +downstreamnt
atgccctccgacctggccaagaagaaggcagccaaaaagaaggaggctgccaaagctcga
cagcggcccagaaaaggacatgaagaaaatggagatgttgtcacagaaccacaggtggca
gagaagaatgaggccaatggcagagagaccacagaagtagatttgctgaccaaggagcta
gaggactttgagatgaagaaagctgctgctcgagctgtcactggcgtcctggcctctcac
cccaacagtactgatgttcacatcatcaacctctcacttacctttcatggtcaagagctg
ctcagtgacaccaaactggaattaaactcaggccgtcgttatggcctcattggtttaaat
ggaattggaaagtccatgctgctctctgctattgggaagcgtgaagtgcccatccctgag
cacatcgacatctaccatctgactcgagagatgccccctagtgacaagacacccttgcat
tgtgtgatggaagtcgacacagagcgggccatgctggagaaagaggcagagcggctggct
catgaggatgcggagtgtgagaagctcatggagctctacgagcgcctggaggagctggat
gccgacaaggcagagatgagggcctcgcggatcttgcatggactgggtttcacacctgcc
atgcagcgcaagaagctaaaagacttcagtgggggctggaggatgagggttgcccttgcc
agagccctctttattcggcccttcatgctgctcctggatgagcctaccaaccacctggac
ctagatgcttgcgtgtggttggaagaagaactaaaaacttttaagcgcatcttggtcctc
gtctcccattcccaggattttctgaatggtgtctgtaccaatatcattcacatgcacaac
aagaaactgaagtattatacgggtaattatgatcagtacgtgaagacgcggctagagctg
gaggagaaccagatgaagaggtttcactgggagcaagatcagattgcacacatgaagaac
tacattgcgaggtttggtcatggcagtgccaagctggcccggcaggcccagagcaaggag
aagacgctacagaaaatgatggcatcaggactgacagagagggtcgtgagcgataagaca
ctgtcattttatttcccaccatgtggcaagatccctccacctgtcattatggtgcaaaat
gtgagcttcaagtatacaaaagatgggccttgcatctacaataatctagaatttggaatt
gaccttgacacacgagtggctctggtagggcccaatggagcagggaagtcaactcttctg
aagctgctaactggagagctactacccacagatggcatgatccgaaaacactctcatgtc
aagatagggcgttaccatcagcatttacaagagcagctggacttagatctctcacctttg
gagtacatgatgaagtgctacccagagatcaaggagaaggaagaaatgaggaagatcatt
gggcgatacggtctcactgggaaacaacaggtgagcccaatccggaacttgtcagacggg
cagaagtgccgagtgtgtctggcctggctggcctggcagaacccccacatgctcttcctg
gatgaacccaccaatcacctggatatcgagaccatcgacgccctggcagatgccatcaat
gagtttgagggtggtatgatgctggtcagccatgacttcagactcattcagcaggttgca
caggaaatttgggtctgtgagaagcagacaatcaccaagtggcctggagacatcctggct
tacaaggagcacctcaagtccaagctggtggatgaggagccccagctcaccaagaggacc
cacaacgtgtga

DBGET integrated database retrieval system