KEGG   Homo sapiens (human): 10393
Entry
10393             CDS       T01001                                 
Symbol
ANAPC10, APC10, DOC1
Name
(RefSeq) anaphase promoting complex subunit 10
  KO
K03357  anaphase-promoting complex subunit 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04914  Progesterone-mediated oocyte maturation
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06130  Cell cycle (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06230  Cell cycle
  Element
N00221  HTLV-1 Tax to spindle assembly checkpoint signaling
N00493  Spindle assembly checkpoint signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    10393 (ANAPC10)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    10393 (ANAPC10)
   04114 Oocyte meiosis
    10393 (ANAPC10)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    10393 (ANAPC10)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    10393 (ANAPC10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    10393 (ANAPC10)
   03036 Chromosome and associated proteins [BR:hsa03036]
    10393 (ANAPC10)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     10393 (ANAPC10)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    10393 (ANAPC10)
SSDB
Motif
Pfam: ANAPC10 F5_F8_type_C PITH
Other DBs
NCBI-GeneID: 10393
NCBI-ProteinID: NP_001243635
OMIM: 613745
HGNC: 24077
Ensembl: ENSG00000164162
Pharos: Q9UM13(Tbio)
UniProt: Q9UM13
Structure
Position
4:complement(144994575..145098571)
AA seq 185 aa
MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQ
PHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWI
HVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMM
YRSIR
NT seq 558 nt   +upstreamnt  +downstreamnt
atgactacaccaaacaagacacctcctggtgctgaccccaagcagttggaaaggactgga
acagtacgggaaattgggtcacaagctgtttggtcactctcatcttgcaaaccaggattt
ggagtggatcagttacgagatgacaatctagaaacttattggcaatcagatggttcccag
cctcatttagtgaacatccaattcagaagaaaaacaacagtgaagacattatgtatttat
gcagactacaaatctgatgaaagctatactccaagcaagatctcagtcagagtaggaaat
aattttcacaaccttcaagaaattcggcaacttgagttggtggaaccaagtggctggatt
catgttcccttaactgacaatcataagaagccaactcgtacattcatgatacagattgct
gttctagccaatcaccagaatggaagagacacccatatgagacaaattaaaatatacaca
ccagtagaagagagctccattggtaaatttcctagatgtacaactatagatttcatgatg
tatcgttcaataaggtga

KEGG   Homo sapiens (human): 119504
Entry
119504            CDS       T01001                                 
Symbol
ANAPC16, APC16, C10orf104, CENP-27, MSAG, bA570G20.3
Name
(RefSeq) anaphase promoting complex subunit 16
  KO
K25229  anaphase-promoting complex subunit 16
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04914  Progesterone-mediated oocyte maturation
hsa05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    119504 (ANAPC16)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    119504 (ANAPC16)
   04114 Oocyte meiosis
    119504 (ANAPC16)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    119504 (ANAPC16)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    119504 (ANAPC16)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    119504 (ANAPC16)
   03036 Chromosome and associated proteins [BR:hsa03036]
    119504 (ANAPC16)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     119504 (ANAPC16)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    119504 (ANAPC16)
SSDB
Motif
Pfam: ANAPC16 DUF2110
Other DBs
NCBI-GeneID: 119504
NCBI-ProteinID: NP_001229475
OMIM: 613427
HGNC: 26976
Ensembl: ENSG00000166295
Pharos: Q96DE5(Tdark)
UniProt: Q96DE5 C5H3H2
Structure
Position
10:72216012..72235860
AA seq 110 aa
MAASSSSSSAGGVSGSSVTGSGFSVSDLAPPRKALFTYPKGAGEMLEDGSERFLCESVFS
YQVASTLKQVKHDQQVARMEKLAGLVEELEADEWRFKPIEQLLGFTPSSG
NT seq 333 nt   +upstreamnt  +downstreamnt
atggctgcttcatcatcatcctcctcagctggtggggtcagtggaagttctgtcactgga
tctggtttcagtgtctcagaccttgccccaccacggaaagcccttttcacctaccccaaa
ggagctggagagatgttagaagatggctctgagagattcctctgcgaatctgtttttagc
tatcaagtggcatccacgcttaaacaggtgaaacatgatcagcaagttgctcggatggaa
aaactagctggtttggtagaagagctggaggctgacgagtggcggtttaagcccatcgag
cagctgctgggattcaccccctcttcaggttga

KEGG   Homo sapiens (human): 246184
Entry
246184            CDS       T01001                                 
Symbol
CDC26, ANAPC12, APC12, C9orf17
Name
(RefSeq) cell division cycle 26
  KO
K03359  anaphase-promoting complex subunit 12
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04914  Progesterone-mediated oocyte maturation
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06130  Cell cycle (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06230  Cell cycle
  Element
N00221  HTLV-1 Tax to spindle assembly checkpoint signaling
N00493  Spindle assembly checkpoint signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    246184 (CDC26)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    246184 (CDC26)
   04114 Oocyte meiosis
    246184 (CDC26)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    246184 (CDC26)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    246184 (CDC26)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    246184 (CDC26)
   03036 Chromosome and associated proteins [BR:hsa03036]
    246184 (CDC26)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     246184 (CDC26)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    246184 (CDC26)
SSDB
Motif
Pfam: ANAPC_CDC26
Other DBs
NCBI-GeneID: 246184
NCBI-ProteinID: NP_644815
OMIM: 614533
HGNC: 17839
Ensembl: ENSG00000176386
Pharos: Q8NHZ8(Tbio)
UniProt: Q8NHZ8 A0A024R832
Structure
Position
9:complement(113266992..113275572)
AA seq 85 aa
MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQM
INDRIGYKPQPKPNNRSSQFGSLEF
NT seq 258 nt   +upstreamnt  +downstreamnt
atgctgagacggaaaccaacacgcctagagctaaagcttgatgacattgaagagtttgag
aacattcgaaaggacctggagacccgtaagaaacagaaggaagatgtggaagttgtagga
ggcagtgatggagaaggagccattgggcttagcagtgatcccaagagccgggaacaaatg
atcaatgatcggattggttataaaccccaacccaagcccaataatcgttcatctcaattt
ggaagtcttgaattttag

KEGG   Homo sapiens (human): 25847
Entry
25847             CDS       T01001                                 
Symbol
ANAPC13, APC13, SWM1
Name
(RefSeq) anaphase promoting complex subunit 13
  KO
K12456  anaphase-promoting complex subunit 13
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04914  Progesterone-mediated oocyte maturation
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06130  Cell cycle (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06230  Cell cycle
  Element
N00221  HTLV-1 Tax to spindle assembly checkpoint signaling
N00493  Spindle assembly checkpoint signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    25847 (ANAPC13)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    25847 (ANAPC13)
   04114 Oocyte meiosis
    25847 (ANAPC13)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    25847 (ANAPC13)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    25847 (ANAPC13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    25847 (ANAPC13)
   03036 Chromosome and associated proteins [BR:hsa03036]
    25847 (ANAPC13)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     25847 (ANAPC13)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    25847 (ANAPC13)
SSDB
Motif
Pfam: Apc13p
Other DBs
NCBI-GeneID: 25847
NCBI-ProteinID: NP_001229303
OMIM: 614484
HGNC: 24540
Ensembl: ENSG00000129055
Pharos: Q9BS18(Tbio)
UniProt: Q9BS18 A8K3Z6
Structure
Position
3:complement(134477704..134486023)
AA seq 74 aa
MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDL
ALQYLHENVPPIGN
NT seq 225 nt   +upstreamnt  +downstreamnt
atggacagtgaggttcagagagatggaaggatcttggatttgattgatgatgcttggcga
gaagacaagctgccttatgaggatgtcgcaataccactgaatgagcttcctgaacctgaa
caagacaatggtggcaccacagaatctgtcaaagaacaagaaatgaagtggacagactta
gccttacagtacctccatgagaatgttccccccattggaaactga

KEGG   Homo sapiens (human): 25906
Entry
25906             CDS       T01001                                 
Symbol
ANAPC15, APC15, C11orf51, HSPC020
Name
(RefSeq) anaphase promoting complex subunit 15
  KO
K25228  anaphase-promoting complex subunit 15
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04914  Progesterone-mediated oocyte maturation
hsa05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    25906 (ANAPC15)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    25906 (ANAPC15)
   04114 Oocyte meiosis
    25906 (ANAPC15)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    25906 (ANAPC15)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    25906 (ANAPC15)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    25906 (ANAPC15)
   03036 Chromosome and associated proteins [BR:hsa03036]
    25906 (ANAPC15)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     25906 (ANAPC15)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    25906 (ANAPC15)
SSDB
Motif
Pfam: ANAPC15 RNA_pol_Rpc4 DUF2457 V_ATPase_I
Other DBs
NCBI-GeneID: 25906
NCBI-ProteinID: NP_001265416
OMIM: 614717
HGNC: 24531
Ensembl: ENSG00000110200
Pharos: P60006(Tdark)
UniProt: P60006 A0A024R5G0
Structure
Position
11:complement(72106372..72112780)
AA seq 121 aa
MSTLFPSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASE
HYDDEEEEDDEDDEDSEEDSEDDEDMQDMDEMNDYNESPDDGEVNEVDMEGNEQDQDQWM
I
NT seq 366 nt   +upstreamnt  +downstreamnt
atgtccactttgttcccctcactcttccctcgtgtgactgagactctgtggtttaatctg
gatcgaccctgtgtggaagagacagagctgcagcagcaggaacagcagcatcaggcctgg
ctccaaagcatcgcggagaaagacaacaacctggttcctattggcaagccagcctcagag
cactatgatgacgaggaagaagaggatgatgaagatgatgaggatagtgaagaggactca
gaggatgatgaggatatgcaggacatggacgagatgaatgactacaatgagtcaccggat
gatggagaggtcaatgaggtggacatggaaggcaacgaacaggatcaggaccagtggatg
atctag

KEGG   Homo sapiens (human): 29882
Entry
29882             CDS       T01001                                 
Symbol
ANAPC2, APC2
Name
(RefSeq) anaphase promoting complex subunit 2
  KO
K03349  anaphase-promoting complex subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04914  Progesterone-mediated oocyte maturation
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06130  Cell cycle (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06230  Cell cycle
  Element
N00221  HTLV-1 Tax to spindle assembly checkpoint signaling
N00493  Spindle assembly checkpoint signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    29882 (ANAPC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    29882 (ANAPC2)
   04114 Oocyte meiosis
    29882 (ANAPC2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    29882 (ANAPC2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    29882 (ANAPC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    29882 (ANAPC2)
   03036 Chromosome and associated proteins [BR:hsa03036]
    29882 (ANAPC2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Cullin
     29882 (ANAPC2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    29882 (ANAPC2)
SSDB
Motif
Pfam: Cullin ANAPC2
Other DBs
NCBI-GeneID: 29882
NCBI-ProteinID: NP_037498
OMIM: 606946
HGNC: 19989
Ensembl: ENSG00000176248
Pharos: Q9UJX6(Tbio)
UniProt: Q9UJX6
Structure
Position
9:complement(137174784..137188560)
AA seq 822 aa
MAAAVVVAEGDSDSRPGQELLVAWNTVSTGLVPPAALGLVSSRTSGAVPPKEEELRAAVE
VLRGHGLHSVLEEWFVEVLQNDLQANISPEFWNAISQCENSADEPQCLLLLLDAFGLLES
RLDPYLRSLELLEKWTRLGLLMGTGAQGLREEVHTMLRGVLFFSTPRTFQEMIQRLYGCF
LRVYMQSKRKGEGGTDPELEGELDSRYARRRYYRLLQSPLCAGCSSDKQQCWCRQALEQF
HQLSQVLHRLSLLERVSAEAVTTTLHQVTRERMEDRCRGEYERSFLREFHKWIERVVGWL
GKVFLQDGPARPASPEAGNTLRRWRCHVQRFFYRIYASLRIEELFSIVRDFPDSRPAIED
LKYCLERTDQRQQLLVSLKAALETRLLHPGVNTCDIITLYISAIKALRVLDPSMVILEVA
CEPIRRYLRTREDTVRQIVAGLTGDSDGTGDLAVELSKTDPASLETGQDSEDDSGEPEDW
VPDPVDADPGKSSSKRRSSDIISLLVSIYGSKDLFINEYRSLLADRLLHQFSFSPEREIR
NVELLKLRFGEAPMHFCEVMLKDMADSRRINANIREEDEKRPAEEQPPFGVYAVILSSEF
WPPFKDEKLEVPEDIRAALEAYCKKYEQLKAMRTLSWKHTLGLVTMDVELADRTLSVAVT
PVQAVILLYFQDQASWTLEELSKAVKMPVALLRRRMSVWLQQGVLREEPPGTFSVIEEER
PQDRDNMVLIDSDDESDSGMASQADQKEEELLLFWTYIQAMLTNLESLSLDRIYNMLRMF
VVTGPALAEIDLQELQGYLQKKVRDQQLVYSAGVYRLPKNCS
NT seq 2469 nt   +upstreamnt  +downstreamnt
atggcggcggcagttgtggtggcggagggggacagcgactcccggcccggacaggagttg
ttagtggcctggaacaccgtgagcaccggcctggtgccgccggctgcgctggggctggtg
tcttcccggaccagcggtgcagtcccgccaaaggaagaggagctccgggcggcggtggag
gttctgaggggccacgggctacactcggtcctggaggagtggttcgtggaggtgctgcag
aacgatctgcaggccaacatctcccctgagttctggaatgccatctcccaatgcgagaac
tctgcggatgagccccagtgccttttgctactccttgacgcttttggcctgctggagagc
cgcctggatccctacctgcgtagcctagagctgctggagaaatggactcgcctgggcttg
ctgatgggcactggtgctcaggggctgcgagaagaagtccacactatgttgcgcggagtc
ttgttctttagcacccccagaaccttccaagagatgatccagcgtctgtatgggtgcttc
ttgagagtctatatgcagagtaagaggaagggggaagggggcacagacccggaactggaa
ggggagctggacagccggtatgcccgtcgccggtactaccggctcctgcagagcccgctg
tgtgcagggtgcagcagtgacaagcaacagtgctggtgtcgccaggctctggagcagttc
catcagctcagccaggtcttacacaggctcagtctgctggagcgggtcagtgccgaggct
gtgaccaccaccctgcaccaggtgacccgggagaggatggaggaccgttgccggggcgag
tacgagcgctccttcctgcgtgagttccacaagtggatcgagcgggtggtcggctggctc
ggcaaggtgttcctgcaggacggccccgccaggcccgcatctcccgaggccggcaacacc
ctgcgccgctggcgctgccacgtgcaaaggttcttctaccgcatctacgccagcctgcgc
atcgaggagctcttcagcatcgtccgagacttcccagactcccggccagccatcgaggac
ctcaagtactgcctggagaggacggaccagaggcagcagctgctcgtgtccctcaaggct
gccctggagactcggctcctgcatccaggcgtcaacacgtgtgacatcatcaccctctat
atctctgccatcaaggcgctgcgcgtgctggacccttccatggtcatcctggaggtggcc
tgtgagcctatccgccgctacctgaggacgcgggaggacacagtgcggcagattgtggct
gggctgacgggggactcggacgggacaggggacctggctgttgagctgtccaagaccgac
ccggcgagcctggagacaggccaggacagtgaggatgactcaggcgagccagaggactgg
gtcccggaccctgtggatgccgatccagggaagtcgagctccaagcggcgttcatcggac
atcatcagcctgctggtcagcatctacggcagcaaggacctcttcatcaatgagtaccgc
tcgctgctggccgaccgcctgctgcaccagttcagcttcagccccgagcgggagatccgc
aacgtggagctgctgaagctgcgctttggcgaggccccaatgcacttctgtgaagtcatg
ctgaaggacatggcggactcccgccgcatcaatgccaacatccgggaggaggatgagaag
cggccagcagaggagcagccaccgttcggggtctacgctgtcatcctgtccagtgagttc
tggccgcccttcaaggacgagaagctggaggtccccgaggatatcagggcagccctggag
gcttactgcaagaagtatgagcagctcaaggccatgcggaccctcagttggaagcacacc
ctgggcctggtgaccatggacgtggagctggccgaccgcacgctgtctgtggcggtcacc
ccagtacaggcggtgatcttgctgtattttcaggaccaagccagctggaccctggaggaa
ctgagcaaggcggtgaagatgcccgtggcgctgctgcggcggcggatgtccgtgtggctg
cagcagggtgtgctgcgtgaggagccccccggcaccttctctgtcattgaggaggagcgg
cctcaggaccgggacaacatggtgctcattgacagtgacgacgagagcgactccggcatg
gcctcccaggccgaccagaaggaggaggagctgctgctcttctggacgtacatccaggcc
atgctgaccaacctggagagcctctcactggatcgtatctacaacatgctccgcatgttt
gtggtgactgggcctgcactggccgagattgacctgcaggagctgcagggctacctgcag
aagaaggtgcgggaccagcagctcgtctactcggccggcgtctaccgcctgcccaagaac
tgcagctga

KEGG   Homo sapiens (human): 29945
Entry
29945             CDS       T01001                                 
Symbol
ANAPC4, APC4
Name
(RefSeq) anaphase promoting complex subunit 4
  KO
K03351  anaphase-promoting complex subunit 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04914  Progesterone-mediated oocyte maturation
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06130  Cell cycle (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06230  Cell cycle
  Element
N00221  HTLV-1 Tax to spindle assembly checkpoint signaling
N00493  Spindle assembly checkpoint signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    29945 (ANAPC4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    29945 (ANAPC4)
   04114 Oocyte meiosis
    29945 (ANAPC4)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    29945 (ANAPC4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    29945 (ANAPC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    29945 (ANAPC4)
   03036 Chromosome and associated proteins [BR:hsa03036]
    29945 (ANAPC4)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     29945 (ANAPC4)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    29945 (ANAPC4)
SSDB
Motif
Pfam: ANAPC4 ANAPC4_WD40
Other DBs
NCBI-GeneID: 29945
NCBI-ProteinID: NP_037499
OMIM: 606947
HGNC: 19990
Ensembl: ENSG00000053900
Pharos: Q9UJX5(Tbio)
UniProt: Q9UJX5
Structure
Position
4:25377263..25418498
AA seq 808 aa
MLRFPTCFPSFRVVGEKQLPQEIIFLVWSPKRDLIALANTAGEVLLHRLASFHRVWSFPP
NENTGKEVTCLAWRPDGKLLAFALADTKKIVLCDVEKPESLHSFSVEAPVSCMHWMEVTV
ESSVLTSFYNAEDESNLLLPKLPTLPKNYSNTSKIFSEENSDEIIKLLGDVRLNILVLGG
SSGFIELYAYGMFKIARVTGIAGTCLALCLSSDLKSLSVVTEVSTNGASEVSYFQLETNL
LYSFLPEVTRMARKFTHISALLQYINLSLTCMCEAWEEILMQMDSRLTKFVQEKNTTTSV
QDEFMHLLLWGKASAELQTLLMNQLTVKGLKKLGQSIESSYSSIQKLVISHLQSGSESLL
YHLSELKGMASWKQKYEPLGLDAAGIEEAITAVGSFILKANELLQVIDSSMKNFKAFFRW
LYVAMLRMTEDHVLPELNKMTQKDITFVAEFLTEHFNEAPDLYNRKGKYFNVERVGQYLK
DEDDDLVSPPNTEGNQWYDFLQNSSHLKESPLLFPYYPRKSLHFVKRRMENIIDQCLQKP
ADVIGKSMNQAICIPLYRDTRSEDSTRRLFKFPFLWNNKTSNLHYLLFTILEDSLYKMCI
LRRHTDISQSVSNGLIAIKFGSFTYATTEKVRRSIYSCLDAQFYDDETVTVVLKDTVGRE
GRDRLLVQLPLSLVYNSEDSAEYQFTGTYSTRLDEQCSAIPTRTMHFEKHWRLLESMKAQ
YVAGNGFRKVSCVLSSNLRHVRVFEMDIDDEWELDESSDEEEEASNKPVKIKEEVLSESE
AENQQAGAAALAPEIVIKVEKLDPELDS
NT seq 2427 nt   +upstreamnt  +downstreamnt
atgttgcgttttccgacctgtttcccatccttccgggtggtgggagagaagcagctcccg
caggagattattttcctggtctggtcgcccaagcgggatctcattgctttggccaacaca
gctggcgaggttttacttcatcgactggcaagttttcatcgagtttggagttttccacca
aatgaaaatacaggaaaggaggtgacgtgtctggcatggagaccagatggcaaacttttg
gcctttgctcttgctgataccaagaaaattgttttgtgtgatgtagaaaaacctgagagc
ttacactctttttctgtggaggctccagtttcctgtatgcattggatggaagtgacagta
gaaagcagtgttctcacatcattttataatgctgaggatgaatcaaatcttctcttacct
aaactacctacactgccaaaaaactatagcaacacctcaaaaatatttagtgaagaaaat
tctgatgaaattattaagctcttgggagacgtcaggcttaatattctcgtccttggagga
agctctggatttattgagctttatgcttatggaatgtttaaaattgctcgagtcacaggg
attgctggtacttgtcttgcattatgtttatcaagtgatttgaaatcattatcagtggtc
acagaagtctctaccaatggtgcttcagaagtttcatactttcagcttgaaactaatctg
ttgtactctttcttacctgaagtaactcggatggccagaaagtttactcatatttcagct
ctgttacagtatataaatttgtcactaacatgtatgtgtgaagcatgggaagaaatacta
atgcagatggattctcgtctcaccaagtttgtgcaggaaaagaacacaaccacatcagtg
caagatgagttcatgcacttgctattatgggggaaagcaagtgctgaacttcagactctc
ttgatgaatcagttaacagtaaagggcttgaaaaagcttggccagtctatagagtcatca
tactccagtatacaaaaattggtcataagtcatttacagagtggctcggagtctttatta
taccatttgagtgaattgaaaggaatggcttcatggaagcaaaaatatgaacctcttgga
ctagatgctgcaggaatcgaagaagctataactgctgtgggttcttttatactcaaggca
aatgaacttcttcaagttatagatagtagtatgaaaaacttcaaagcattttttcggtgg
ctttatgtggcaatgttgagaatgacagaagaccatgtgcttcccgagctgaataagatg
actcagaaagatatcacatttgttgctgaatttcttactgaacatttcaatgaggctcca
gacctttataatcgaaaaggaaaatactttaacgttgaaagagttggtcagtacttgaaa
gatgaagatgatgatcttgtgtcaccccctaacacagaaggaaaccagtggtatgacttt
cttcaaaatagcagccaccttaaagaaagtcctttgctgtttccttattatcctcgaaaa
tcattgcattttgtgaaaaggcggatggagaatattattgatcagtgtttgcaaaagcca
gcagatgtaattggaaaatcgatgaatcaagcaatctgtattccattgtatagagatacc
agaagtgaggattctacacgtagattgttcaaatttccttttctgtggaataataaaact
tcaaatctacattatcttctttttactattctagaagattcactttataaaatgtgcatc
ttaaggagacatactgatatttctcaatctgtgagtaatggactaattgctattaaattt
gggagctttacatatgccacaacagaaaaagtcagaagaagcatctacagttgtttagat
gcacagttttatgatgatgaaactgtaacagtagttcttaaagacactgtaggacgtgaa
ggaagagatagactcttggtccagctgcctttgtctttagtatataacagtgaagattct
gcagaatatcagttcactgggacttattctacaaggctagatgaacagtgtagtgctatt
cccacccgtaccatgcattttgagaagcactggagattactggaaagtatgaaagcacag
tatgttgctgggaatggttttcgaaaagtgtcctgtgtgttaagctcaaatcttcgtcat
gtgagagtatttgaaatggacatagatgatgaatgggagctcgatgagtcttcagatgaa
gaggaggaggccagtaataagcctgtaaaaataaaggaagaagtgttgtcggagtcagag
gcagagaaccaacaagctggtgctgccgctttagctccagagatagtcattaaagtggaa
aaacttgaccctgagctagactcctaa

KEGG   Homo sapiens (human): 51433
Entry
51433             CDS       T01001                                 
Symbol
ANAPC5, APC5
Name
(RefSeq) anaphase promoting complex subunit 5
  KO
K03352  anaphase-promoting complex subunit 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04657  IL-17 signaling pathway
hsa04914  Progesterone-mediated oocyte maturation
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06130  Cell cycle (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06230  Cell cycle
  Element
N00221  HTLV-1 Tax to spindle assembly checkpoint signaling
N00493  Spindle assembly checkpoint signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    51433 (ANAPC5)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    51433 (ANAPC5)
   04114 Oocyte meiosis
    51433 (ANAPC5)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    51433 (ANAPC5)
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    51433 (ANAPC5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    51433 (ANAPC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    51433 (ANAPC5)
   03036 Chromosome and associated proteins [BR:hsa03036]
    51433 (ANAPC5)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     51433 (ANAPC5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    51433 (ANAPC5)
SSDB
Motif
Pfam: ANAPC5 TPR_12 TPR_10 TPR_2 TPR_7 VP4_haemagglut TPR_19
Other DBs
NCBI-GeneID: 51433
NCBI-ProteinID: NP_057321
OMIM: 606948
HGNC: 15713
Ensembl: ENSG00000089053
Pharos: Q9UJX4(Tbio)
UniProt: Q9UJX4
Structure
Position
12:complement(121308245..121354209)
AA seq 755 aa
MASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKIAVLVLLNEMSRTGEGAVSLMERRRL
NQLLLPLLQGPDITLSKLYKLIEESCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDSFS
GTEPEVHKTSVVGLFLRHMILAYSKLSFSQVFKLYTALQQYFQNGEKKTVEDADMELTSR
DEGERKMEKEELDVSVREEEVSCSGPLSQKQAEFFLSQQASLLKNDETKALTPASLQKEL
NNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDRLILTGAESKSNGEEGYGRSL
RYAALNLAALHCRFGHYQQAELALQEAIRIAQESNDHVCLQHCLSWLYVLGQKRSDSYVL
LEHSVKKAVHFGLPYLASLGIQSLVQQRAFAGKTANKLMDALKDSDLLHWKHSLSELIDI
SIAQKTAIWRLYGRSTMALQQAQMLLSMNSLEAVNAGVQQNNTESFAVALCHLAELHAEQ
GCFAAASEVLKHLKERFPPNSQHAQLWMLCDQKIQFDRAMNDGKYHLADSLVTGITALNS
IEGVYRKAVVLQAQNQMSEAHKLLQKLLVHCQKLKNTEMVISVLLSVAELYWRSSSPTIA
LPMLLQALALSKEYRLQYLASETVLNLAFAQLILGIPEQALSLLHMAIEPILADGAILDK
GRAMFLVAKCQVASAASYDQPKKAEALEAAIENLNEAKNYFAKVDCKERIRDVVYFQARL
YHTLGKTQERNRCAMLFRQLHQELPSHGVPLINHL
NT seq 2268 nt   +upstreamnt  +downstreamnt
atggccagcgtccacgagagcctctacttcaatcccatgatgaccaatggggttgtgcac
gccaatgtgttcggcatcaaggactgggtgacgccgtacaagatcgcggtgctggtgctg
ctgaacgagatgagccgcacaggcgagggcgccgtcagcctcatggagcggcggaggctc
aaccagctgctcctgcccctgctgcagggcccagatattacactgtcaaaactttacaag
ttaattgaagagtcttgtccacagctggcaaattcagtgcagatcagaatcaaactgatg
gctgaaggcgagttgaaggatatggaacagttttttgatgacctttcagattctttctct
ggaactgaaccagaggttcacaaaacaagtgtagtaggtttgtttctgcgtcacatgatc
ttggcctacagtaagctttctttcagccaagtgtttaaactgtacactgcccttcagcag
tacttccagaatggtgagaaaaagacagtggaggatgctgatatggaactgaccagtaga
gatgagggtgaaagaaaaatggaaaaagaagaacttgatgtatctgtaagagaagaggag
gtatcttgcagtgggcctctgtcccaaaaacaagcagaattttttctttctcaacaggct
tctttgctaaagaatgatgagactaaggccctcactccagcttccttgcagaaggaatta
aacaatttgttgaaatttaatcctgattttgctgaagcgcattatctcagctacttaaac
aacctccgtgtccaagatgttttcagttcaacacacagtctcctccattattttgatcgt
ctgattcttaccggagccgaaagcaaaagtaatggggaagagggctatggccggagcttg
agatacgccgctctgaatcttgccgccctgcactgccgcttcggtcactatcaacaggca
gagctcgccctgcaggaggcaattaggattgcccaggagtccaacgatcacgtgtgtctc
cagcactgtttgagctggctttatgtgctggggcagaagagatccgatagctatgttctg
ctggagcattctgtgaagaaggcagtacattttgggttaccgtacctcgcctccctggga
atacagtcccttgttcaacagagagcttttgctgggaagacggcaaacaagctgatggat
gccctaaaggactccgacctcctgcactggaaacacagcctgtcagagctcatcgatatc
agcatcgcacagaaaacggccatctggaggctgtatggccgcagcaccatggcactgcaa
caggcccagatgttgctgagcatgaacagcctggaggcggtgaatgcgggcgtgcagcag
aacaacacagagtcctttgctgtcgcactctgccacctcgcagagctacacgcggagcag
ggctgttttgctgcagcttctgaagtgttaaagcacttgaaggaacgatttccgcctaat
agtcagcacgcccagttatggatgctatgtgatcaaaaaatacagtttgacagagcaatg
aatgatggcaaatatcatttggctgattcacttgttacaggaatcacagctctcaatagc
atagagggtgtttataggaaagcggttgtattacaagctcagaaccaaatgtcagaggca
cataagcttttacaaaaattgttggttcattgtcagaaactgaagaacacagaaatggtg
atcagtgtcctactgtccgtggcagagctgtactggcgatcttcctcccctaccatcgcg
ctgcccatgctcctgcaggctctggccctctccaaggagtaccggttacagtacttggcc
tctgaaacagtgctgaacttggcttttgcgcagctcattcttggaatcccagaacaggcc
ttaagtcttctccacatggccatcgagcccatcttggctgacggggctatcctggacaaa
ggtcgtgccatgttcttagtggccaagtgccaggtggcttcagcagcttcctacgatcag
ccgaagaaagcagaagctctggaggctgccatcgagaacctcaatgaagccaagaactat
tttgcaaaggttgactgcaaagagcgcatcagggacgtcgtttacttccaggccagactc
taccataccctggggaagacccaggagaggaaccggtgtgcgatgctcttccggcagctg
catcaggagctgccctctcatggggtacccttgataaaccatctctag

KEGG   Homo sapiens (human): 51434
Entry
51434             CDS       T01001                                 
Symbol
ANAPC7, APC7, FERBON
Name
(RefSeq) anaphase promoting complex subunit 7
  KO
K03354  anaphase-promoting complex subunit 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04914  Progesterone-mediated oocyte maturation
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06130  Cell cycle (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06230  Cell cycle
  Element
N00221  HTLV-1 Tax to spindle assembly checkpoint signaling
N00493  Spindle assembly checkpoint signaling
Disease
H02584  Ferguson-Bonni neurodevelopmental syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    51434 (ANAPC7)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    51434 (ANAPC7)
   04114 Oocyte meiosis
    51434 (ANAPC7)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    51434 (ANAPC7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    51434 (ANAPC7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    51434 (ANAPC7)
   03036 Chromosome and associated proteins [BR:hsa03036]
    51434 (ANAPC7)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     51434 (ANAPC7)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    51434 (ANAPC7)
SSDB
Motif
Pfam: TPR_2 TPR_8 TPR_1 TPR_16 TPR_14 TPR_19 ANAPC3 TPR_7 TPR_11 TPR_12 ChAPs TPR_17 TPR_21 TPR_10 BTAD
Other DBs
NCBI-GeneID: 51434
NCBI-ProteinID: NP_057322
OMIM: 606949
HGNC: 17380
Ensembl: ENSG00000196510
Pharos: Q9UJX3(Tbio)
UniProt: Q9UJX3 A0A024RBJ3 Q4KMX6 Q69YV3
Structure
Position
12:complement(110372900..110403708)
AA seq 565 aa
MNVIDHVRDMAAAGLHSNVRLLSSLLLTMSNNNPELFSPPQKYQLLVYHADSLFHDKEYR
NAVSKYTMALQQKKALSKTSKVRPSTGNSASTPQSQCLPSEIEVKYKMAECYTMLKQDKD
AIAILDGIPSRQRTPKINMMLANLYKKAGQERPSVTSYKEVLRQCPLALDAILGLLSLSV
KGAEVASMTMNVIQTVPNLDWLSVWIKAYAFVHTGDNSRAISTICSLEKKSLLRDNVDLL
GSLADLYFRAGDNKNSVLKFEQAQMLDPYLIKGMDVYGYLLAREGRLEDVENLGCRLFNI
SDQHAEPWVVSGCHSFYSKRYSRALYLGAKAIQLNSNSVQALLLKGAALRNMGRVQEAII
HFREAIRLAPCRLDCYEGLIECYLASNSIREAMVMANNVYKTLGANAQTLTLLATVCLED
PVTQEKAKTLLDKALTQRPDYIKAVVKKAELLSREQKYEDGIALLRNALANQSDCVLHRI
LGDFLVAVNEYQEAMDQYSIALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSG
EEGDLEGSDSEAAQWADQEQWFGMQ
NT seq 1698 nt   +upstreamnt  +downstreamnt
atgaatgtgatagaccacgtgcgggacatggcggccgcggggctgcactccaacgtgcgg
ctcctcagcagcttgttacttacaatgagtaataacaaccctgagttattctccccacct
cagaagtaccagcttttggtgtatcatgcagattctctctttcatgataaggaatatcgg
aatgctgtgagtaagtataccatggctttacagcagaagaaagcgctaagtaaaacttca
aaagtgagaccttcaactggaaattctgcatctactccacaaagtcagtgtcttccatct
gaaattgaagtgaaatacaaaatggctgaatgttatacaatgctaaaacaagataaagat
gccattgctatacttgatgggatcccttcaagacaaagaactcccaaaataaacatgatg
ctggcaaacctgtacaagaaggctggtcaggagcgcccttcagtcaccagctataaggag
gtgctgaggcagtgcccattagcccttgatgccattctaggcttgttgtccctttctgta
aaaggggcagaggtggcatccatgacaatgaatgtgatccaaaccgtgcctaacttggac
tggctctctgtgtggatcaaagcgtatgcttttgtgcacactggtgacaactcaagagca
atcagtaccatctgttcactagagaaaaaatccttattgcgagataacgtggacctattg
ggaagcttggcagatctgtacttcagagctggagacaataaaaactctgtcctcaagttt
gaacaggcacagatgttggatccttatctgataaaaggaatggatgtatatggctaccta
ctggcacgagaagggcggctagaggatgttgagaaccttggatgccgccttttcaatatc
tctgatcagcatgcagaaccgtgggtggtttctggctgtcacagcttctatagcaaacgc
tactcccgggccctctatttaggagccaaggccattcagctgaacagtaatagtgttcaa
gctctgctacttaagggagcagcacttaggaacatgggcagagtccaagaagcaataatc
cactttcgggaggccatacggctcgcaccttgtcgcttagattgttatgaaggtcttatc
gaatgttacttagcctccaacagtattcgagaagcaatggtaatggctaacaacgtttac
aaaactctgggagcaaatgcacagacccttacccttttagccaccgtttgtcttgaagac
ccagtgacacaggagaaagccaaaacattattagataaagccctgacccaaaggccagat
tacattaaggctgtggtgaaaaaagcagaactacttagcagagaacagaaatatgaagat
ggaattgctttgctgaggaacgcactggctaatcagagtgactgtgtcctgcatcggatc
ctaggagatttccttgtagctgtcaatgagtatcaggaggcaatggaccagtatagtata
gcactaagtttggaccccaatgaccagaagtctctagaggggatgcagaagatggagaag
gaggagagtcccacggatgccactcaggaggaggatgtggacgacatggaagggagtggg
gaagaaggggacctggagggcagcgacagtgaggcggcccagtgggctgaccaggagcag
tggttcggcatgcagtga

KEGG   Homo sapiens (human): 51529
Entry
51529             CDS       T01001                                 
Symbol
ANAPC11, APC11, Apc11p, HSPC214
Name
(RefSeq) anaphase promoting complex subunit 11
  KO
K03358  anaphase-promoting complex subunit 11
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04914  Progesterone-mediated oocyte maturation
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06130  Cell cycle (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06230  Cell cycle
  Element
N00221  HTLV-1 Tax to spindle assembly checkpoint signaling
N00493  Spindle assembly checkpoint signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    51529 (ANAPC11)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    51529 (ANAPC11)
   04114 Oocyte meiosis
    51529 (ANAPC11)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    51529 (ANAPC11)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    51529 (ANAPC11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    51529 (ANAPC11)
   03036 Chromosome and associated proteins [BR:hsa03036]
    51529 (ANAPC11)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Ring finger protein
     51529 (ANAPC11)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    51529 (ANAPC11)
SSDB
Motif
Pfam: zf-ANAPC11 zf-rbx1 zf-RING_2 zf-C3HC4_2 zf-RING_UBOX
Other DBs
NCBI-GeneID: 51529
NCBI-ProteinID: NP_001002245
OMIM: 614534
HGNC: 14452
Ensembl: ENSG00000141552
Pharos: Q9NYG5(Tbio)
UniProt: Q9NYG5
Structure
Position
17:81890790..81900533
AA seq 84 aa
MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCI
LKWLHAQQVQQHCPMCRQEWKFKE
NT seq 255 nt   +upstreamnt  +downstreamnt
atgaaggtgaagattaagtgctggaacggcgtggccacttggctctgggtggccaacgat
gagaactgtggcatctgcaggatggcatttaacggatgctgccctgactgcaaggtgccc
ggcgacgactgcccgctggtgtggggccagtgctcccactgcttccacatgcattgcatc
ctcaagtggctgcacgcacagcaggtgcagcagcactgccccatgtgccgccaggaatgg
aagttcaaggagtga

DBGET integrated database retrieval system