KEGG   Homo sapiens (human): 10454
Entry
10454             CDS       T01001                                 

Symbol
TAB1, 3'-Tab1, MAP3K7IP1
Name
(RefSeq) TGF-beta activated kinase 1 (MAP3K7) binding protein 1
  KO
K04403  TAK1-binding protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04380  Osteoclast differentiation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04668  TNF signaling pathway
hsa04936  Alcoholic liver disease
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05135  Yersinia infection
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05161  Hepatitis B
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05417  Lipid and atherosclerosis
Network
nt06110  MAPK signaling (viruses and bacteria)
nt06121  TLR signaling (viruses and bacteria)
nt06123  TNF signaling (viruses and bacteria)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06167  Human cytomegalovirus (HCMV)
nt06211  Other MAPK signaling
nt06223  TNF signaling
nt06263  Hepatocellular carcinoma
nt06416  TNF signaling
nt06461  Huntington disease
  Element
N00151  TNF-NFKB signaling pathway
N00186  IL1-IL1R-p38 signaling pathway
N00188  IL1-IL1R-JNK signaling pathway
N00265  EBV LMP1 to NFKB signaling pathway
N00441  HIV gp120 to TNF-NFKB signaling pathway
N00442  HIV Nef to TNF-NFKB signaling pathway
N00444  TNF-p38 signaling pathway
N00446  TNF-JNK signaling pathway
N00466  EBV BPLF1 to TLR2/4-NFKB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    10454 (TAB1)
   04064 NF-kappa B signaling pathway
    10454 (TAB1)
   04668 TNF signaling pathway
    10454 (TAB1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    10454 (TAB1)
   04621 NOD-like receptor signaling pathway
    10454 (TAB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    10454 (TAB1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    10454 (TAB1)
   05161 Hepatitis B
    10454 (TAB1)
   05168 Herpes simplex virus 1 infection
    10454 (TAB1)
   05169 Epstein-Barr virus infection
    10454 (TAB1)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    10454 (TAB1)
   05132 Salmonella infection
    10454 (TAB1)
   05131 Shigellosis
    10454 (TAB1)
   05135 Yersinia infection
    10454 (TAB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    10454 (TAB1)
   05140 Leishmaniasis
    10454 (TAB1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    10454 (TAB1)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    10454 (TAB1)
SSDB
Motif
Pfam: PP2C
Other DBs
NCBI-GeneID: 10454
NCBI-ProteinID: NP_006107
OMIM: 602615
HGNC: 18157
Ensembl: ENSG00000100324
Vega: OTTHUMG00000151102
Pharos: Q15750(Tbio)
UniProt: Q15750 A8K6K3
Structure
Position
22:39399780..39437132
AA seq 504 aa
MAAQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSEN
NCFLYGVFNGYDGNRVTNFVAQRLSAELLLGQLNAEHAEADVRRVLLQAFDVVERSFLES
IDDALAEKASLQSQLPEGVPQHQLPPQYQKILERLKTLEREISGGAMAVVAVLLNNKLYV
ANVGTNRALLCKSTVDGLQVTQLNVDHTTENEDELFRLSQLGLDAGKIKQVGIICGQEST
RRIGDYKVKYGYTDIDLLSAAKSKPIIAEPEIHGAQPLDGVTGFLVLMSEGLYKALEAAH
GPGQANQEIAAMIDTEFAKQTSLDAVAQAVVDRVKRIHSDTFASGGERARFCPRHEDMTL
LVRNFGYPLGEMSQPTPSPAPAAGGRVYPVSVPYSSAQSTSKTSVTLSLVMPSQGQMVNG
AHSASTLDEATPTLTNQSPTLTLQSTNTHTQSSSSSSDGGLFRSRPAHSLPPGEDGRVEP
YVDFAEFYRLWSVDHGEQSVVTAP
NT seq 1515 nt   +upstreamnt  +downstreamnt
atggcggcgcagaggaggagcttgctgcagagtgagcagcagccaagctggacagatgac
ctgcctctctgccacctctctggggttggctcagcctccaaccgcagctactctgctgat
ggcaagggcactgagagccacccgccagaggacagctggctcaagttcaggagtgagaac
aactgcttcctgtatggggtcttcaacggctatgatggcaaccgagtgaccaacttcgtg
gcccagcggctgtccgcagagctcctgctgggccagctgaatgccgagcacgccgaggcc
gatgtgcggcgtgtgctgctgcaggccttcgatgtggtggagaggagcttcctggagtcc
attgacgacgccttggctgagaaggcaagcctccagtcgcaattgccagagggagtccct
cagcaccagctgcctcctcagtatcagaagatccttgagagactcaagacgttagagagg
gaaatttcgggaggggccatggccgttgtggcggtccttctcaacaacaagctctacgtc
gccaatgtcggtacaaaccgtgcacttttatgcaaatcgacagtggatgggttgcaggtg
acacagctgaacgtggaccacaccacagagaacgaggatgagctcttccgtctttcgcag
ctgggcttggatgctggaaagatcaagcaggtggggatcatctgtgggcaggagagcacc
cggcggatcggggattacaaggttaaatatggctacacggacattgaccttctcagcgct
gccaagtccaaaccaatcatcgcagagccagaaatccatggggcacagccgctggatggg
gtgacgggcttcttggtgctgatgtcggaggggttgtacaaggccctagaggcagcccat
gggcctgggcaggccaaccaggagattgctgcgatgattgacactgagtttgccaagcag
acctccctggacgcagtggcccaggccgtcgtggaccgggtgaagcgcatccacagcgac
accttcgccagtggtggggagcgtgccaggttctgcccccggcacgaggacatgaccctg
ctagtgaggaactttggctacccgctgggcgaaatgagccagcccacaccgagcccagcc
ccagctgcaggaggacgagtgtaccctgtgtctgtgccatactccagcgcccagagcacc
agcaagaccagcgtgaccctctcccttgtcatgccctcccagggccagatggtcaacggg
gctcacagtgcttccaccctggacgaagccacccccaccctcaccaaccaaagcccgacc
ttaaccctgcagtccaccaacacgcacacgcagagcagcagctccagctctgacggaggc
ctcttccgctcccggcccgcccactcgctcccgcctggcgaggacggtcgtgttgagccc
tatgtggactttgctgagttttaccgcctctggagcgtggaccatggcgagcagagcgtg
gtgacagcaccgtag

DBGET integrated database retrieval system