KEGG   Homo sapiens (human): 10621
Entry
10621             CDS       T01001                                 

Gene name
POLR3F, C34, RPC39, RPC6
Definition
(RefSeq) RNA polymerase III subunit F
  KO
K03025  DNA-directed RNA polymerase III subunit RPC6
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    10621 (POLR3F)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    10621 (POLR3F)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    10621 (POLR3F)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     10621 (POLR3F)
SSDB
Motif
Pfam: RNA_pol_Rpc34 TrmB CDC24_OB1 TFIIE_alpha
Other DBs
NCBI-GeneID: 10621
NCBI-ProteinID: NP_006457
OMIM: 617455
HGNC: 15763
Ensembl: ENSG00000132664
Vega: OTTHUMG00000031971
Pharos: Q9H1D9(Tdark)
UniProt: Q9H1D9
Structure
PDB: 
2YU3 2DK5

Position
20p11.23
AA seq 316 aa
MAEVKVKVQPPDADPVEIENRIIELCHQFPHGITDQVIQNEMPHIEAQQRAVAINRLLSM
GQLDLLRSNTGLLYRIKDSQNAGKMKGSDNQEKLVYQIIEDAGNKGIWSRDIRYKSNLPL
TEINKILKNLESKKLIKAVKSVAASKKKVYMLYNLQPDRSVTGGAWYSDQDFESEFVEVL
NQQCFKFLQSKAETARESKQNPMIQRNSSFASSHEVWKYICELGISKVELSMEDIETILN
TLIYDGKVEMTIIAAKEGTVGSVDGHMKLYRAVNPIIPPTGLVRAPCGLCPVFDDCHEGG
EISPSNCIYMTEWLEF
NT seq 951 nt   +upstreamnt  +downstreamnt
atggcggaggtgaaggtgaaggtgcagccgcctgacgcggatccggtcgaaatagaaaac
aggattatagaattatgtcaccagttccctcatggaatcacagaccaagtaattcagaat
gaaatgcctcatatagaagcccagcagcgggcagtagccatcaataggttgttgtctatg
ggtcagttggatctcttaaggagcaatacgggccttttatatagaataaaggactctcag
aatgctggtaaaatgaagggatccgataaccaagaaaaactagtatatcaaatcatagag
gatgcaggaaataaaggaatatggagcagagatatccgctataaaagtaatttgccatta
acagaaatcaacaaaattctgaagaatctggaaagtaaaaagcttatcaaagctgttaag
tctgtagcagcctcaaaaaagaaggtgtatatgctctataacctgcagccagaccggtct
gtgactggtggagcctggtacagtgaccaggattttgaatctgaatttgtagaggtgctt
aaccaacagtgttttaaattcctacagtccaaggcagaaacagcacgagaaagcaaacag
aacccaatgatacaaagaaatagttcatttgcctcatcacatgaagtgtggaaatatatc
tgcgaattgggaatcagtaaggtagagttatccatggaagacattgaaaccatcctgaat
acactcatttatgatggaaaagtggagatgacgattattgctgcaaaagaaggcacagtt
ggcagtgtagatggacacatgaaactgtacagggcagtcaatccaatcatccctcccaca
ggtttggtccgggcaccctgtggactctgcccggtttttgatgactgccacgaaggtggt
gagatttcaccatctaactgtatttacatgacagagtggctcgaattttaa

DBGET integrated database retrieval system