KEGG   Homo sapiens (human): 10622
Entry
10622             CDS       T01001                                 

Gene name
POLR3G, C31, RPC32, RPC7
Definition
(RefSeq) RNA polymerase III subunit G
  KO
K03024  DNA-directed RNA polymerase III subunit RPC7
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    10622 (POLR3G)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    10622 (POLR3G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    10622 (POLR3G)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     10622 (POLR3G)
SSDB
Motif
Pfam: RNA_pol_3_Rpc31 DUF4820 SAPS BUD22 Autophagy_act_C
Other DBs
NCBI-GeneID: 10622
NCBI-ProteinID: NP_006458
OMIM: 617456
HGNC: 30075
Ensembl: ENSG00000113356
Vega: OTTHUMG00000162809
Pharos: O15318(Tbio)
UniProt: O15318 A0A024RAM1
Position
5q14.3
AA seq 223 aa
MAGNKGRGRAAYTFNIEAVGFSKGEKLPDVVLKPPPLFPDTDYKPVPLKTGEGEEYMLAL
KQELRETMKRMPYFIETPEERQDIERYSKRYMKVYKEEWIPDWRRLPREMMPRNKCKKAG
PKPKKAKDAGKGTPLTNTEDVLKKMEELEKRGDGEKSDEENEEKEGSKEKSKEGDDDDDD
DAAEQEEYDEEEQEEENDYINSYFEDGDDFGADSDDNMDEATY
NT seq 672 nt   +upstreamnt  +downstreamnt
atggctgggaataaaggaagaggacgtgctgcttatacctttaatattgaggctgttgga
tttagcaaaggtgaaaagttacctgatgtagtgttgaaaccacccccactatttcctgat
acagattataaaccagtgccactgaaaacaggagaaggtgaagaatatatgctggctttg
aaacaggagttgagagaaacaatgaaaagaatgccttattttattgaaacacctgaagaa
agacaagatattgaaaggtatagtaaaagatacatgaaggtatacaaggaagaatggata
ccagattggagaagacttccaagagagatgatgccaagaaataaatgtaaaaaagcaggc
ccaaaacccaaaaaggcaaaagacgcaggcaaaggcacaccactcactaatactgaagat
gtgttgaaaaaaatggaggaattggaaaaaagaggtgatggtgaaaaatcagatgaggaa
aatgaagagaaagaaggaagcaaagagaaaagtaaagaaggtgatgatgacgatgacgat
gatgccgcagaacaggaggaatatgatgaagaagagcaagaagaggaaaatgactacatt
aattcatactttgaagatggagatgattttggcgcagacagtgatgacaacatggatgag
gcaacctattag

KEGG   Homo sapiens (human): 84265
Entry
84265             CDS       T01001                                 

Gene name
POLR3GL, RPC32HOM, flj32422
Definition
(RefSeq) RNA polymerase III subunit GL
  KO
K03024  DNA-directed RNA polymerase III subunit RPC7
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    84265 (POLR3GL)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    84265 (POLR3GL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    84265 (POLR3GL)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     84265 (POLR3GL)
SSDB
Motif
Pfam: RNA_pol_3_Rpc31 Pox_Ag35 DUF87 RNA_pol_Rpc4 NOA36 DUF913 TRAP_alpha DUF4746 MRNIP NPR3 Ax_dynein_light Presenilin DUF4820 BUD22
Other DBs
NCBI-GeneID: 84265
NCBI-ProteinID: NP_115681
OMIM: 617457
HGNC: 28466
Ensembl: ENSG00000121851
Vega: OTTHUMG00000013739
Pharos: Q9BT43(Tbio)
UniProt: Q9BT43
Position
1q21.1
AA seq 218 aa
MASRGGGRGRGRGQLTFNVEAVGIGKGDALPPPTLQPSPLFPPLEFRPVPLPSGEEGEYV
LALKQELRGAMRQLPYFIRPAVPKRDVERYSDKYQMSGPIDNAIDWNPDWRRLPRELKIR
VRKLQKERITILLPKRPPKTTEDKEETIQKLETLEKKEEEVTSEEDEEKEEEEEKEEEEE
EEYDEEEHEEETDYIMSYFDNGEDFGGDSDDNMDEAIY
NT seq 657 nt   +upstreamnt  +downstreamnt
atggccagccggggtgggggccggggtcgtggccggggccagttgaccttcaacgtggag
gccgtgggcattgggaaaggggatgctttgcccccacccaccctgcagccttctccactc
ttccctcccttggagttccgcccagtacctttgccctcaggcgaggaaggggaatatgtc
ctggcactgaagcaagagctacgaggagccatgaggcagctcccctacttcatccggcca
gctgtccccaagagagatgtggagcgttattcagacaaatatcagatgtcaggtccgatt
gacaatgccatcgattggaaccctgattggcggcgtctaccccgggagctaaagatccga
gtgcggaagctacagaaggaacggattacaattctgctccccaagaggccccctaagacc
acagaagataaggaggaaacaatacagaaactagagaccctggagaagaaggaagaagaa
gtaacttcagaggaggatgaggagaaagaagaagaagaagagaaggaagaggaggaagaa
gaagagtatgatgaagaagaacatgaagaggaaactgattacatcatgtcatattttgac
aatggagaggactttggtggtgacagtgatgacaatatggacgaggctatatactga

DBGET integrated database retrieval system