KEGG   Homo sapiens (human): 10623
Entry
10623             CDS       T01001                                 

Gene name
POLR3C, C82, RPC3, RPC62
Definition
(RefSeq) RNA polymerase III subunit C
  KO
K03023  DNA-directed RNA polymerase III subunit RPC3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    10623 (POLR3C)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    10623 (POLR3C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    10623 (POLR3C)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     10623 (POLR3C)
SSDB
Motif
Pfam: RNA_pol_Rpc82 HTH_9 NIT Cut12
Other DBs
NCBI-GeneID: 10623
NCBI-ProteinID: NP_006459
OMIM: 617454
HGNC: 30076
Ensembl: ENSG00000186141
Vega: OTTHUMG00000013753
Pharos: Q9BUI4(Tdark)
UniProt: Q9BUI4
Structure
PDB: 
2XUB 2XV4 5AFQ

Position
1q21.1
AA seq 534 aa
MTQAEIKLCSLLLQEHFGEIVEKIGVHLIRTGSQPLRVIAHDTGTSLDQVKKALCVLVQH
NLVSYQVHKRGVVEYEAQCSRVLRMLRYPRYIYTTKTLYSDTGELIVEELLLNGKLTMSA
VVKKVADRLTETMEDGKTMDYAEVSNTFVRLADTHFVQRCPSVPTTENSDPGPPPPAPTL
VINEKDMYLVPKLSLIGKGKRRRSSDEDAAGEPKAKRPKYTTDNKEPIPDDGIYWQANLD
RFHQHFRDQAIVSAVANRMDQTSSEIVRTMLRMSEITTSSSAPFTQPLSSNEIFRSLPVG
YNISKQVLDQYLTLLADDPLEFVGKSGDSGGGMYVINLHKALASLATATLESVVQERFGS
RCARIFRLVLQKKHIEQKQVEDFAMIPAKEAKDMLYKMLSENFMSLQEIPKTPDHAPSRT
FYLYTVNILSAARMLLHRCYKSIANLIERRQFETKENKRLLEKSQRVEAIIASMQATGAE
EAQLQEIEEMITAPERQQLETLKRNVNKLDASEIQVDETIFLLESYIECTMKRQ
NT seq 1605 nt   +upstreamnt  +downstreamnt
atgactcaagcagaaattaagctctgttctttgttgctgcaagagcattttggagagatt
gtagaaaaaattggagtccatctgataagaaccggcagccagccactaagagtaattgcc
catgacacaggaacatcactggatcaggtgaagaaagccctgtgtgtcctcgtccaacat
aacctggtgagttatcaagtgcacaaacgtggtgtggtggagtatgaagcccagtgcagc
cgggtattgcgaatgcttagatatccccggtacatctatactaccaaaactctgtacagt
gacactggagagctgattgttgaggagcttctgttgaacggcaaactgacaatgtcagct
gttgtgaagaaagtggcagaccggctcacagagaccatggaggatggcaagaccatggac
tatgctgaagtatcaaacacatttgtgcgactggcagacacacactttgtacaacgctgc
ccttcggtacctaccactgagaattcagaccctgggccaccaccacctgcccccacactt
gtcattaatgaaaaggacatgtacctggttcctaaactcagcttgatagggaaaggtaaa
aggaggagatcatctgatgaagatgctgctggggagcccaaggccaagagaccaaaatat
actacagataacaaggagcccattccagatgatgggatttattggcaggccaaccttgac
agattccaccaacacttccgtgaccaagccattgtgagcgcagttgctaacaggatggac
cagacaagcagcgagattgtgcgaaccatgctccgaatgagtgagattaccacttcctct
agtgctcccttcacccagccattgtcttccaatgagatcttcagatccctacctgttggc
tataacatctctaagcaagttcttgatcagtatctcactctgctggcagatgatccacta
gagtttgttggaaagtctggcgacagtggtggaggaatgtatgtcatcaacctccataag
gcattagcatccctagccacagccactctggagtccgtcgtacaggagagatttgggtct
cgctgtgctagaatattccgtctagttttgcagaagaaacacatagagcagaagcaagtg
gaagactttgcaatgattcctgcaaaggaggcaaaggatatgctatataagatgctctca
gaaaatttcatgtcactccaggaaattcccaaaacaccagaccatgccccatccaggacc
ttctatttatatactgtgaacatcctgtcagctgcccgaatgttgttgcacaggtgctac
aagagcatagccaacttgatagaaaggaggcaatttgaaaccaaagagaataagcgtcta
ctagaaaaatctcagagggtagaagccatcattgcatctatgcaggctactggtgcagag
gaagcacagttacaagaaatagaggagatgatcacagctcctgaacgtcagcagctagag
accctgaaacgtaatgtcaacaagttggatgccagtgagatccaggtggacgaaaccatc
ttcctgctggagtcttacattgagtgcaccatgaagagacagtga

DBGET integrated database retrieval system