KEGG   Homo sapiens (human): 115024
Entry
115024            CDS       T01001                                 

Symbol
NT5C3B, NT5C3L, cN-IIIB
Name
(RefSeq) 5'-nucleotidase, cytosolic IIIB
  KO
K24242  cytosolic 5'-nucleotidase 3 [EC:3.1.3.5 3.1.3.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa00240  Pyrimidine metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    115024 (NT5C3B)
   00240 Pyrimidine metabolism
    115024 (NT5C3B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     115024 (NT5C3B)
    3.1.3.-  
     115024 (NT5C3B)
SSDB
Motif
Pfam: UMPH-1 HAD NUC194 HAD_2
Other DBs
NCBI-GeneID: 115024
NCBI-ProteinID: NP_443167
HGNC: 28300
Ensembl: ENSG00000141698
Vega: OTTHUMG00000133499
Pharos: Q969T7(Tdark)
UniProt: Q969T7
Position
17q21.2
AA seq 300 aa
MAEEVSTLMKATVLMRQPGRVQEIVGALRKGGGDRLQVISDFDMTLSRFAYNGKRCPSSY
NILDNSKIISEECRKELTALLHHYYPIEIDPHRTVKEKLPHMVEWWTKAHNLLCQQKIQK
FQIAQVVRESNAMLREGYKTFFNTLYHNNIPLFIFSAGIGDILEEIIRQMKVFHPNIHIV
SNYMDFNEDGFLQGFKGQLIHTYNKNSSACENSGYFQQLEGKTNVILLGDSIGDLTMADG
VPGVQNILKIGFLNDKVEERRERYMDSYDIVLEKDETLDVVNGLLQHILCQGVQLEMQGP
NT seq 903 nt   +upstreamnt  +downstreamnt
atggcagaggaggtgagcaccctgatgaaggccacggtcctgatgcggcagcctgggcgg
gtgcaggagatcgtgggcgccctccgcaagggcggcggagaccggttacaggtgatttct
gattttgacatgaccttgagcaggtttgcatataatggaaagcgatgcccttcttcttac
aatattctggataatagcaagatcatcagtgaggagtgtcggaaagagctcacagcgctc
cttcaccactattacccaattgagatcgacccacaccggaccgtcaaggagaagctacct
catatggtggaatggtggaccaaagcacacaatctcctatgtcagcagaagattcagaag
tttcagatagcccaggtggttagagagtccaatgcaatgctcagggagggatataagacc
ttcttcaacacactctaccataacaacattccccttttcatcttttctgcgggcattggt
gatatcctggaagaaattatccgacagatgaaagtgttccaccccaacatccacatcgtg
tctaactacatggattttaatgaagatggttttctccagggatttaagggccagctcata
cacacatacaacaagaacagctctgcgtgtgagaactctggttacttccagcaacttgag
ggcaaaaccaatgtcatcctgctgggagactctatcggggacctcaccatggccgatggg
gttcctggtgtgcagaacattctcaaaattggcttcctgaatgacaaggtggaggagcgg
cgggagcgctacatggactcctatgacatcgtgctggagaaggacgagactctggatgtg
gtcaacgggctactgcagcacatcctgtgccagggggtccagctggagatgcaaggcccc
tga

DBGET integrated database retrieval system