KEGG   Homo sapiens (human): 1371
Entry
1371              CDS       T01001                                 
Symbol
CPOX, COX, CPO, CPX, HARPO, HCP
Name
(RefSeq) coproporphyrinogen oxidase
  KO
K00228  coproporphyrinogen III oxidase [EC:1.3.3.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00860  Porphyrin metabolism
hsa01100  Metabolic pathways
hsa01240  Biosynthesis of cofactors
Module
hsa_M00868  Heme biosynthesis, animals and fungi, glycine => heme
Network
nt06011  Heme biosynthesis
  Element
N00601  Heme biosynthesis
Disease
H00202  Hepatic porphyria
H01763  Porphyria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin metabolism
    1371 (CPOX)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.3  coproporphyrinogen oxidase
     1371 (CPOX)
SSDB
Motif
Pfam: Coprogen_oxidas
Other DBs
NCBI-GeneID: 1371
NCBI-ProteinID: NP_000088
OMIM: 612732
HGNC: 2321
Ensembl: ENSG00000080819
Pharos: P36551(Tbio)
UniProt: P36551
Structure
Position
3:complement(98570488..98593611)
AA seq 454 aa
MALQLGRLSSGPCWLVARGGCGGPRAWSQCGGGGLRAWSQRSAAGRVCRPPGPAGTEQSR
GLGHGSTSRGGPWVGTGLAAALAGLVGLATAAFGHVQRAEMLPKTSGTRATSLGRPEEEE
DELAHRCSSFMAPPVTDLGELRRRPGDMKTKMELLILETQAQVCQALAQVDGGANFSVDR
WERKEGGGGISCVLQDGCVFEKAGVSISVVHGNLSEEAAKQMRSRGKVLKTKDGKLPFCA
MGVSSVIHPKNPHAPTIHFNYRYFEVEEADGNKQWWFGGGCDLTPTYLNQEDAVHFHRTL
KEACDQHGPDLYPKFKKWCDDYFFIAHRGERRGIGGIFFDDLDSPSKEEVFRFVQSCARA
VVPSYIPLVKKHCDDSFTPQEKLWQQLRRGRYVEFNLLYDRGTKFGLFTPGSRIESILMS
LPLTARWEYMHSPSENSKEAEILEVLRHPRDWVR
NT seq 1365 nt   +upstreamnt  +downstreamnt
atggccttgcagctgggcaggctgagctcgggcccctgctggctcgtggcgcggggcggc
tgcggagggccccgcgcctggtcccagtgcggcggcggagggctccgagcctggtcccag
cgcagcgcagccggacgcgtctgccggccccctggcccggctggcacggagcagagccgc
gggctggggcacggctcgacgtcgagaggcggcccctgggtggggacagggctggccgcg
gcgctggcggggttggtggggctggccaccgccgccttcgggcatgtgcagcgggcggag
atgttgcctaagacctcggggacgcgggccacttcgctggggaggccggaggaggaggag
gatgagctggcccaccgctgcagcagcttcatggccccgcctgtgaccgacctgggcgag
ctgcgaaggaggccgggcgacatgaagaccaagatggagctgctgattctggagacccag
gcccaggtgtgccaggctctggcacaggtagacgggggcgccaacttttctgtggaccgg
tgggagaggaaggaaggaggtggcggcatcagctgtgtacttcaagatgggtgtgttttc
gaaaaggctggggtgagcatttctgttgttcatggaaatctttcagaggaagctgcaaaa
caaatgagaagcagaggaaaagttctgaagactaaagatggtaaattgccattttgtgct
atgggcgtgagctctgttatccaccccaagaatcctcatgctcctactatccatttcaac
tacagatactttgaagtagaagaagctgatggcaacaagcagtggtggtttggtggtgga
tgtgacctcactccaacatacttgaatcaagaagacgctgtccattttcacagaactctg
aaggaggcttgtgaccagcatggtccagatctctaccccaaatttaaaaaatggtgtgat
gattacttctttatagcccatcgtggagaacggcggggcattggtggtatcttttttgat
gatcttgactctccgtccaaggaggaggtgtttcgctttgtacagagctgtgccagggct
gtagttccttcttacattccccttgtgaaaaagcactgtgatgactcattcaccccccag
gagaagctgtggcagcagctcagaagaggacggtatgtagaatttaatctgctgtatgat
cggggcacaaagtttggcctcttcactccaggatccagaattgaaagtatcttgatgtct
ttacctctaactgcccgatgggagtacatgcattcaccctcagagaattccaaagaagct
gaaattctggaagttctacgccatccaagggactgggtgcgttga

DBGET integrated database retrieval system