KEGG   Homo sapiens (human): 143471
Entry
143471            CDS       T01001                                 

Gene name
PSMA8, PSMA7L
Definition
(RefSeq) proteasome 20S subunit alpha 8
  KO
K02731  20S proteasome subunit alpha 4 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
N01197  Scrapie conformation PrPSc to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    143471 (PSMA8)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    143471 (PSMA8)
   05012 Parkinson disease
    143471 (PSMA8)
   05014 Amyotrophic lateral sclerosis
    143471 (PSMA8)
   05016 Huntington disease
    143471 (PSMA8)
   05017 Spinocerebellar ataxia
    143471 (PSMA8)
   05020 Prion disease
    143471 (PSMA8)
   05022 Pathways of neurodegeneration - multiple diseases
    143471 (PSMA8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    143471 (PSMA8)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    143471 (PSMA8)
   03051 Proteasome [BR:hsa03051]
    143471 (PSMA8)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     143471 (PSMA8)
Peptidases and inhibitors [BR:hsa01002]
 Threonine peptidases
  Family T1: proteasome family
   143471 (PSMA8)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab associated proteins
    143471 (PSMA8)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    143471 (PSMA8)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N Myb_DNA-bind_5 DUF4372
Other DBs
NCBI-GeneID: 143471
NCBI-ProteinID: NP_653263
OMIM: 617841
HGNC: 22985
Ensembl: ENSG00000154611
Vega: OTTHUMG00000179426
Pharos: Q8TAA3(Tdark)
UniProt: Q8TAA3
Position
18q11.2
AA seq 256 aa
MASRYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGIRGTNIVVLGVEKKSVAKLQDERT
VRKICALDDHVCMAFAVLTIFIGLTADARVVINRARVECQSHKLTVEDPVTVEYITRFIA
TLKQKYTQSNGRRPFGISALIVGFDDDGISRLYQTDPSGTYHAWKANAIGRSAKTVREFL
EKNYTEDAIASDSEAIKLAIKALLEVVQSGGKNIELAIIRRNQPLKMFSAKEVELYVTEI
EKEKEEAEKKKSKKSV
NT seq 771 nt   +upstreamnt  +downstreamnt
atggcgtctcgatatgacagggcgatcactgtcttctccccagacggacacctttttcaa
gttgaatatgcccaggaagcggtgaagaaaggatccaccgcggtcggaattcgaggtacc
aatatagttgttcttggggtagaaaaaaaatctgttgccaagcttcaagatgaaagaact
gtgaggaaaatttgtgcccttgatgaccatgtctgcatggcttttgcagttttgacaatt
tttataggacttactgctgatgctagagtagtaataaacagagcccgtgtggagtgccag
agccataagcttacggttgaggacccagtcactgtagaatacataactcgcttcatagca
actttaaagcagaaatatacccaaagcaatggacgaagaccttttggtatttctgcctta
attgtaggttttgatgatgatggtatctcaagattgtatcagacagatccttctggtact
tatcatgcttggaaggcaaatgcaataggccgaagtgctaaaactgttcgagaatttcta
gaaaagaattacacagaagatgccatagcaagtgacagtgaagctatcaagttagcaata
aaagctttgctagaagttgtccagtctggtggaaaaaacattgaacttgctataataaga
agaaatcaacctttgaagatgtttagtgcaaaagaagttgaattatatgtaactgaaata
gaaaaggaaaaggaagaagcagagaagaaaaaatcaaagaaatctgtctaa

DBGET integrated database retrieval system