KEGG   Homo sapiens (human): 210
Entry
210               CDS       T01001                                 
Symbol
ALAD, ALADH, PBGS
Name
(RefSeq) aminolevulinate dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00860  Porphyrin metabolism
hsa01100  Metabolic pathways
hsa01240  Biosynthesis of cofactors
Module
hsa_M00868  Heme biosynthesis, animals and fungi, glycine => heme
Network
nt06011  Heme biosynthesis
  Element
N00601  Heme biosynthesis
Disease
H00202  Hepatic porphyria
H01763  Porphyria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin metabolism
    210 (ALAD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    210 (ALAD)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     210 (ALAD)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   210 (ALAD)
SSDB
Motif
Pfam: ALAD
Other DBs
NCBI-GeneID: 210
NCBI-ProteinID: NP_000022
OMIM: 125270
HGNC: 395
Ensembl: ENSG00000148218
Pharos: P13716(Tbio)
UniProt: P13716 A0A140VJL9 Q6ZMU0
Structure
Position
9:complement(113386312..113401284)
AA seq 330 aa
MQPQSVLHSGYFHPLLRAWQTATTTLNASNLIYPIFVTDVPDDIQPITSLPGVARYGVKR
LEEMLRPLVEEGLRCVLIFGVPSRVPKDERGSAADSEESPAIEAIHLLRKTFPNLLVACD
VCLCPYTSHGHCGLLSENGAFRAEESRQRLAEVALAYAKAGCQVVAPSDMMDGRVEAIKE
ALMAHGLGNRVSVMSYSAKFASCFYGPFRDAAKSSPAFGDRRCYQLPPGARGLALRAVDR
DVREGADMLMVKPGMPYLDIVREVKDKHPDLPLAVYHVSGEFAMLWHGAQAGAFDLKAAV
LEAMTAFRRAGADIIITYYTPQLLQWLKEE
NT seq 993 nt   +upstreamnt  +downstreamnt
atgcagccccagtccgttctgcacagcggctacttccacccactacttcgggcctggcag
acagccaccaccaccctcaatgcctccaacctcatctaccccatctttgtcacggatgtt
cctgatgacatacagcctatcaccagcctcccaggagtggccaggtatggtgtgaagcgg
ctggaagagatgctgaggcccttggtggaagagggcctacgctgtgtcttgatctttggc
gtccccagcagagttcccaaggacgagcggggttccgcagctgactccgaggagtcccca
gctattgaggcaatccatctgttgaggaagaccttccccaacctcctggtggcctgtgat
gtctgcctgtgtccctacacctcccatggtcactgcgggctcctgagtgaaaacggagca
ttccgggctgaggagagccgccagcggctggctgaggtggcattggcgtatgccaaggca
ggatgtcaggtggtagccccgtcggacatgatggatggacgcgtggaagccatcaaagag
gccctgatggcacatggacttggcaacagggtatcggtgatgagctacagtgccaaattt
gcttcctgtttctatggccctttccgggatgcagctaagtcaagcccagcttttggggac
cgccgctgctaccagctgccccctggagcacgaggcctggctctccgagctgtggaccgg
gatgtacgggaaggagctgacatgctcatggtgaagccgggaatgccctacctggacatc
gtgcgggaggtaaaggacaagcaccctgacctccctctcgccgtgtaccacgtctctgga
gagtttgccatgctgtggcatggagcccaggccggggcatttgatctcaaggctgccgta
ctggaggccatgactgccttccgcagagcaggtgctgacatcatcatcacctactacaca
ccgcagctgctgcagtggctgaaggaggaatga

DBGET integrated database retrieval system