KEGG   Homo sapiens (human): 221830
Entry
221830            CDS       T01001                                 

Gene name
POLR1F, A43, RPA43, TWISTNB
Definition
(RefSeq) RNA polymerase I subunit F
  KO
K03004  DNA-directed RNA polymerase I subunit RPA43
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    221830 (POLR1F)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    221830 (POLR1F)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase I system
   RNA polymerase I
    Pol I specific subunits
     221830 (POLR1F)
SSDB
Motif
Pfam: RPA43_OB SHS2_Rpb7-N
Other DBs
NCBI-GeneID: 221830
NCBI-ProteinID: NP_001002926
OMIM: 608312
HGNC: 18027
Ensembl: ENSG00000105849
Vega: OTTHUMG00000152497
Pharos: Q3B726(Tdark)
UniProt: Q3B726
Position
7p21.1
AA seq 338 aa
MAAGCSEAPRPAAASDGSLVGQAGVLPCLELPTYAAACALVNSRYSCLVAGPHQRHIALS
PRYLNRKRTGIREQLDAELLRYSESLLGVPIAYDNIKVVGELGDIYDDQGHIHLNIEADF
VIFCPEPGQKLMGIVNKVSSSHIGCLVHGCFNASIPKPEQLSAEQWQTMEINMGDELEFE
VFRLDSDAAGVFCIRGKLNITSLQFKRSEVSEEVTENGTEEAAKKPKKKKKKKDPETYEV
DSGTTKLADDADDTPMEESALQNTNNANGIWEEEPKKKKKKKKHQEVQDQDPVFQGSDSS
GYQSDHKKKKKKRKHSEEAEFTPPLKCSPKRKGKSNFL
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggctgcaggttgctcagaggcgccgcggccagcggcggcttctgatgggtctctggta
gggcaggctggcgtcctgccttgcctagagttgccgacttatgccgctgcttgtgcgctg
gtgaacagtcgctactcatgcctggtggccgggccgcaccaaaggcacatcgcgctgtcg
ccccgctaccttaacaggaaacgcaccggcattcgagaacagcttgatgcggagctcctt
cgctattctgagagccttttaggtgtccctattgcatatgataacatcaaagttgtggga
gagcttggagatatttatgatgatcaaggacacattcatcttaacattgaagccgatttt
gttattttctgccctgaaccagggcagaagcttatgggtatagttaataaagtgtcttct
agccacattggctgtttagtacatgggtgtttcaatgcctccattcctaaacctgagcag
ttgtcagctgagcagtggcaaaccatggagataaacatgggtgatgaactagaatttgaa
gtatttcgtttagactcagatgctgctggagtattctgcattcggggaaaactaaatatc
acaagtttacaattcaagcgctctgaagtttctgaagaagttacagaaaatggcactgag
gaagctgctaaaaaacctaaaaagaagaaaaagaagaaagacccagagacatatgaagtg
gacagtggtaccacaaagctagcagatgatgcagatgacactccaatggaagagtcagcc
ctgcagaatactaataatgcgaatggcatctgggaggaggagccaaagaaaaagaagaag
aagaaaaagcaccaggaagttcaggaccaggaccctgttttccaaggcagtgactccagt
ggttaccaaagtgaccataaaaagaaaaaaaagaaaagaaaacacagtgaagaggccgaa
tttaccccacctttgaaatgctcaccaaaaagaaaagggaaaagtaattttctttag

DBGET integrated database retrieval system