KEGG   Homo sapiens (human): 246721
Entry
246721            CDS       T01001                                 

Gene name
POLR2J2, HRPB11B, POLR2J3, RPB11b1, RPB11b2
Definition
(RefSeq) RNA polymerase II subunit J2
  KO
K03008  DNA-directed RNA polymerase II subunit RPB11
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    246721 (POLR2J2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    246721 (POLR2J2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    246721 (POLR2J2)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    246721 (POLR2J2)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Core subunits
     246721 (POLR2J2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      246721 (POLR2J2)
SSDB
Motif
Pfam: RNA_pol_L_2 RNA_pol_L
Other DBs
NCBI-GeneID: 246721
NCBI-ProteinID: NP_116581
OMIM: 609881
HGNC: 23208
Ensembl: ENSG00000267645
Vega: OTTHUMG00000180801
UniProt: Q9GZM3
Position
7q22.1
AA seq 115 aa
MNAPPAFESFLLFEGEKITINKDTKVPKACLFTINKEDHTLGNIIKSQLLKDPQVLFAGY
KVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRTCLLPLRLLP
NT seq 348 nt   +upstreamnt  +downstreamnt
atgaacgcccctccagccttcgagtcgttcttgctcttcgagggcgagaagatcaccatt
aacaaggacaccaaggtacccaaggcctgcttattcaccatcaacaaagaagaccacaca
ctgggaaacatcattaaatcacaactcctaaaagacccgcaagtgctatttgctggctac
aaagtcccccaccccttggagcacaagatcatcatccgagtgcagaccacgccggactac
agcccccaggaagcctttaccaacgccatcaccgacctcatcagtgagctgtccctgctg
gaggagcgcttccggacgtgcctgcttccccttcgccttctgccgtga

KEGG   Homo sapiens (human): 5439
Entry
5439              CDS       T01001                                 

Gene name
POLR2J, POLR2J1, RPB11, RPB11A, RPB11m, hRPB14
Definition
(RefSeq) RNA polymerase II subunit J
  KO
K03008  DNA-directed RNA polymerase II subunit RPB11
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    5439 (POLR2J)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    5439 (POLR2J)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    5439 (POLR2J)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5439 (POLR2J)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Core subunits
     5439 (POLR2J)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      5439 (POLR2J)
SSDB
Motif
Pfam: RNA_pol_L_2 RNA_pol_L SHNi-TPR
Other DBs
NCBI-GeneID: 5439
NCBI-ProteinID: NP_006225
OMIM: 604150
HGNC: 9197
Ensembl: ENSG00000005075
Vega: OTTHUMG00000150387
Pharos: P52435(Tbio)
UniProt: P52435
Structure
PDB: 

Position
7q22.1
AA seq 117 aa
MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAG
YKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE
NT seq 354 nt   +upstreamnt  +downstreamnt
atgaacgcccctccagccttcgagtcgttcttgctcttcgagggcgagaagaagatcacc
attaacaaggacaccaaggtacccaatgcctgtttattcaccatcaacaaagaagaccac
acactgggaaacatcattaaatcacaactcctaaaagacccgcaagtgctatttgctggc
tacaaagtcccccaccccttggagcacaagatcatcatccgagtgcagaccacgccggac
tacagcccccaggaagcctttaccaacgccatcaccgacctcatcagtgagctgtccctg
ctggaggagcgctttcgggtggccataaaagacaagcaggaaggaattgagtag

KEGG   Homo sapiens (human): 548644
Entry
548644            CDS       T01001                                 

Gene name
POLR2J3, POLR2J2, RPB11b1, RPB11b2
Definition
(RefSeq) RNA polymerase II subunit J3
  KO
K03008  DNA-directed RNA polymerase II subunit RPB11
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    548644 (POLR2J3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    548644 (POLR2J3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    548644 (POLR2J3)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    548644 (POLR2J3)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Core subunits
     548644 (POLR2J3)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      548644 (POLR2J3)
SSDB
Motif
Pfam: RNA_pol_L_2 RNA_pol_L
Other DBs
NCBI-GeneID: 548644
NCBI-ProteinID: NP_001091084
HGNC: 33853
Ensembl: ENSG00000168255
Vega: OTTHUMG00000150384
Pharos: Q9GZM3(Tdark)
UniProt: Q9GZM3 A0A0B4J2F8
Position
7q22.1
AA seq 115 aa
MNAPPAFESFLLFEGEKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGY
KVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRTCLLPLRLLP
NT seq 348 nt   +upstreamnt  +downstreamnt
atgaacgcccctccagccttcgagtcgttcttgctcttcgagggcgagaagatcaccatt
aacaaggacaccaaggtacccaatgcctgtttattcaccatcaacaaagaagaccacaca
ctgggaaacatcattaaatcacaactcctaaaagacccgcaagtgctatttgctggctac
aaagtcccccaccccttggagcacaagatcatcatccgagtgcagaccacgccggactac
agcccccaggaagcctttaccaacgccatcaccgacctcatcagtgagctgtccctgctg
gaggagcgcttccggacgtgcctgcttccccttcgccttctgccgtga

DBGET integrated database retrieval system