KEGG   Homo sapiens (human): 2523
Entry
2523              CDS       T01001                                 
Symbol
FUT1, H, HH, HSC
Name
(RefSeq) fucosyltransferase 1 (H blood group)
  KO
K00718  galactoside 2-L-fucosyltransferase 1/2 [EC:2.4.1.69]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00601  Glycosphingolipid biosynthesis - lacto and neolacto series
hsa00603  Glycosphingolipid biosynthesis - globo and isoglobo series
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    2523 (FUT1)
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    2523 (FUT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    2523 (FUT1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    2523 (FUT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.69  type 1 galactoside alpha-(1,2)-fucosyltransferase
     2523 (FUT1)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  ABO blood group
   2523 (FUT1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Others
   Fucosyltransferase
    2523 (FUT1)
SSDB
Motif
Pfam: Glyco_transf_11 O-FucT
Other DBs
NCBI-GeneID: 2523
NCBI-ProteinID: NP_000139
OMIM: 211100
HGNC: 4012
Ensembl: ENSG00000174951
Pharos: P19526(Tbio)
UniProt: P19526 Q6IZA2
Position
19:complement(48748011..48755358)
AA seq 365 aa
MWLRSHRQLCLAFLLVCVLSVIFFLHIHQDSFPHGLGLSILCPDRRLVTPPVAIFCLPGT
AMGPNASSSCPQHPASLSGTWTVYPNGRFGNQMGQYATLLALAQLNGRRAFILPAMHAAL
APVFRITLPVLAPEVDSRTPWRELQLHDWMSEEYADLRDPFLKLSGFPCSWTFFHHLREQ
IRREFTLHDHLREEAQSVLGQLRLGRTGDRPRTFVGVHVRRGDYLQVMPQRWKGVVGDSA
YLRQAMDWFRARHEAPVFVVTSNGMEWCKENIDTSQGDVTFAGDGQEATPWKDFALLTQC
NHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFLKIFKPEAAFLPEWVGINADLSPLW
TLAKP
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgtggctccggagccatcgtcagctctgcctggccttcctgctagtctgtgtcctctct
gtaatcttcttcctccatatccatcaagacagctttccacatggcctaggcctgtcgatc
ctgtgtccagaccgccgcctggtgacacccccagtggccatcttctgcctgccgggtact
gcgatgggccccaacgcctcctcttcctgtccccagcaccctgcttccctctccggcacc
tggactgtctaccccaatggccggtttggtaatcagatgggacagtatgccacgctgctg
gctctggcccagctcaacggccgccgggcctttatcctgcctgccatgcatgccgccctg
gccccggtattccgcatcaccctgcccgtgctggccccagaagtggacagccgcacgccg
tggcgggagctgcagcttcacgactggatgtcggaggagtacgcggacttgagagatcct
ttcctgaagctctctggcttcccctgctcttggactttcttccaccatctccgggaacag
atccgcagagagttcaccctgcacgaccaccttcgggaagaggcgcagagtgtgctgggt
cagctccgcctgggccgcacaggggaccgcccgcgcacctttgtcggcgtccacgtgcgc
cgtggggactatctgcaggttatgcctcagcgctggaagggtgtggtgggcgacagcgcc
tacctccggcaggccatggactggttccgggcacggcacgaagcccccgttttcgtggtc
accagcaacggcatggagtggtgtaaagaaaacatcgacacctcccagggcgatgtgacg
tttgctggcgatggacaggaggctacaccgtggaaagactttgccctgctcacacagtgc
aaccacaccattatgaccattggcaccttcggcttctgggctgcctacctggctggcgga
gacactgtctacctggccaacttcaccctgccagactctgagttcctgaagatctttaag
ccggaggcggccttcctgcccgagtgggtgggcattaatgcagacttgtctccactctgg
acattggctaagccttga

DBGET integrated database retrieval system