KEGG   Homo sapiens (human): 25885
Entry
25885             CDS       T01001                                 

Gene name
POLR1A, A190, AFDCIN, RPA1, RPA190, RPA194, RPO1-4, RPO14
Definition
(RefSeq) RNA polymerase I subunit A
  KO
K02999  DNA-directed RNA polymerase I subunit RPA1 [EC:2.7.7.6]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
Disease
H01376  Acrofacial dysostosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    25885 (POLR1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    25885 (POLR1A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     25885 (POLR1A)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase I system
   RNA polymerase I
    Core subunits
     25885 (POLR1A)
SSDB
Motif
Pfam: RNA_pol_Rpb1_5 RNA_pol_Rpb1_2 RNA_pol_Rpb1_3 RNA_pol_Rpb1_4 RNA_pol_Rpb1_1 NOA36
Other DBs
NCBI-GeneID: 25885
NCBI-ProteinID: NP_056240
OMIM: 616404
HGNC: 17264
Ensembl: ENSG00000068654
Vega: OTTHUMG00000153165
Pharos: O95602(Tchem)
UniProt: O95602
Position
2p11.2
AA seq 1720 aa
MLISKNMPWRRLQGISFGMYSAEELKKLSVKSITNPRYLDSLGNPSANGLYDLALGPADS
KEVCSTCVQDFSNCSGHLGHIELPLTVYNPLLFDKLYLLLRGSCLNCHMLTCPRAVIHLL
LCQLRVLEVGALQAVYELERILNRFLEENPDPSASEIREELEQYTTEIVQNNLLGSQGAH
VKNVCESKSKLIALFWKAHMNAKRCPHCKTGRSVVRKEHNSKLTITFPAMVHRTAGQKDS
EPLGIEEAQIGKRGYLTPTSAREHLSALWKNEGFFLNYLFSGMDDDGMESRFNPSVFFLD
FLVVPPSRYRPVSRLGDQMFTNGQTVNLQAVMKDVVLIRKLLALMAQEQKLPEEVATPTT
DEEKDSLIAIDRSFLSTLPGQSLIDKLYNIWIRLQSHVNIVFDSEMDKLMMDKYPGIRQI
LEKKEGLFRKHMMGKRVDYAARSVICPDMYINTNEIGIPMVFATKLTYPQPVTPWNVQEL
RQAVINGPNVHPGASMVINEDGSRTALSAVDMTQREAVAKQLLTPATGAPKPQGTKIVCR
HVKNGDILLLNRQPTLHRPSIQAHRARILPEEKVLRLHYANCKAYNADFDGDEMNAHFPQ
SELGRAEAYVLACTDQQYLVPKDGQPLAGLIQDHMVSGASMTTRGCFFTREHYMELVYRG
LTDKVGRVKLLSPSILKPFPLWTGKQVVSTLLINIIPEDHIPLNLSGKAKITGKAWVKET
PRSVPGFNPDSMCESQVIIREGELLCGVLDKAHYGSSAYGLVHCCYEIYGGETSGKVLTC
LARLFTAYLQLYRGFTLGVEDILVKPKADVKRQRIIEESTHCGPQAVRAALNLPEAASYD
EVRGKWQDAHLGKDQRDFNMIDLKFKEEVNHYSNEINKACMPFGLHRQFPENSLQMMVQS
GAKGSTVNTMQISCLLGQIELEGRRPPLMASGKSLPCFEPYEFTPRAGGFVTGRFLTGIK
PPEFFFHCMAGREGLVDTAVKTSRSGYLQRCIIKHLEGLVVQYDLTVRDSDGSVVQFLYG
EDGLDIPKTQFLQPKQFPFLASNYEVIMKSQHLHEVLSRADPKKALHHFRAIKKWQSKHP
NTLLRRGAFLSYSQKIQEAVKALKLESENRNGRSPGTQEMLRMWYELDEESRRKYQKKAA
ACPDPSLSVWRPDIYFASVSETFETKVDDYSQEWAAQTEKSYEKSELSLDRLRTLLQLKW
QRSLCEPGEAVGLLAAQSIGEPSTQMTLNTFHFAGRGEMNVTLGIPRLREILMVASANIK
TPMMSVPVLNTKKALKRVKSLKKQLTRVCLGEVLQKIDVQESFCMEEKQNKFQVYQLRFQ
FLPHAYYQQEKCLRPEDILRFMETRFFKLLMESIKKKNNKASAFRNVNTRRATQRDLDNA
GELGRSRGEQEGDEEEEGHIVDAEAEEGDADASDAKRKEKQEEEVDYESEEEEEREGEEN
DDEDMQEERNPHREGARKTQEQDEEVGLGTEEDPSLPALLTQPRKPTHSQEPQGPEAMER
RVQAVREIHPFIDDYQYDTEESLWCQVTVKLPLMKINFDMSSLVVSLAHGAVIYATKGIT
RCLLNETTNNKNEKELVLNTEGINLPELFKYAEVLDLRRLYSNDIHAIANTYGIEAALRV
IEKEIKDVFAVYGIAVDPRHLSLVADYMCFEGVYKPLNRFGIRSNSSPLQQMTFETSFQF
LKQATMLGSHDELRSPSACLVVGKVVRGGTGLFELKQPLR
NT seq 5163 nt   +upstreamnt  +downstreamnt
atgttgatctccaagaacatgccctggcggcggctgcagggcatttccttcgggatgtat
tcggctgaagagctcaagaaattaagtgttaaatccattacgaaccctcgatacctggac
agcctggggaacccatcggcaaacggcctgtacgatttagctttgggccctgcagattcc
aaagaggtgtgctccacctgcgtgcaggacttcagcaactgttctgggcacctgggccac
attgagctcccactcacagtgtataaccctctcctcttcgataagctgtacctgctgctt
cggggctcttgtttaaactgccacatgctgacttgtccccgggccgtgattcacctctta
ctctgccagctgagggttctggaagtcggggccctacaagcagtctacgagcttgagaga
attctgaacaggtttctggaagaaaatcccgatccctctgcctctgaaattcgggaggaa
ttagaacaatacacaactgaaattgtgcagaacaacctcctggggtcccagggcgcacat
gtaaagaacgtgtgtgagagcaagagcaagctcattgctctcttctggaaggcacatatg
aatgctaagcgctgtccccactgcaagaccgggcgatccgttgtccgaaaggaacacaac
agcaagttgactatcacgtttccagccatggtgcacaggacagctggccagaaggactct
gagcccctgggaattgaggaagctcagataggaaaacgaggatacttaacacccaccagt
gcccgcgaacacctttctgccctgtggaagaatgaaggattctttctgaactaccttttt
tcgggaatggatgatgatggtatggaatccagattcaatcccagtgtgttctttctagat
ttcttggtggtgccgccctcaaggtatcgcccagtcagtcgcctaggagaccagatgttt
actaatggccagacggtgaacttgcaggctgtcatgaaggatgtagttctgattcgaaaa
cttctggcattgatggcccaagaacagaagttgccagaggaagtggccacacccactaca
gatgaggaaaaagactctttgattgctattgaccgatcctttttgagtacacttccaggc
cagtccctcatagacaaactttacaacatttggattcgccttcagagccacgtcaatatt
gtgtttgatagcgagatggacaaactaatgatggacaagtacccaggcattaggcagatc
ctggagaagaaagaaggcctgttccgaaaacacatgatgggaaagcgagtggactacgct
gcgcgctcagtcatctgcccagacatgtacatcaacaccaacgaaattggaattcccatg
gtgtttgccacaaaactgacctacccacagccagttaccccatggaatgttcaggaactt
aggcaagcggtcatcaacggccctaatgtgcacccaggagcctccatggtcatcaatgag
gacggcagccgcacagccctgagcgctgtggacatgacccagcgagaggccgtggccaag
cagcttctgaccccagccacgggggcacctaagccccaggggacaaaaattgtgtgccgg
catgtgaagaatggggacattctgctactgaaccgacagcccacactgcacagaccctcc
atccaggcccaccgtgcccgcatcctgcctgaagagaaagtgctgcggctccactatgcc
aactgcaaggcctataatgccgactttgatggagacgagatgaatgcccatttcccccag
agtgagctgggccgggccgaggcctacgtcctggcctgcactgatcagcagtaccttgtt
cccaaggatggccaaccattggcgggactgatccaggatcacatggtttcaggggcaagc
atgactactcggggttgctttttcacccgggagcactatatggagctggtgtaccgagga
ctcacggacaaagtggggcgcgtgaagctcctttctccttccatcctgaagccctttccg
ctgtggacaggaaaacaggttgtgtcaacgctgctcataaatataatcccagaggaccac
atcccactgaacttatctggaaaggcgaaaatcactgggaaagcctgggtgaaggaaact
cctcgatccgttcctggctttaaccctgactcgatgtgcgagtcccaggtgatcatcagg
gaaggggagctgctctgcggagtgctggacaaggcgcactatgggagctccgcctacggc
ctggtccactgctgctatgagatctatggaggcgagaccagcggcaaggttctaacctgc
ctggcccgcctcttcaccgcctacctgcagctctacagaggcttcaccttgggcgtggaa
gacattttggtgaagccaaaggcagatgtcaagaggcaacgtatcattgaagaatccacc
cactgcgggccccaggctgtcagggctgcattaaacctgccagaagccgcatcatatgat
gaggtccgaggaaaatggcaggatgcccatctgggcaaggaccagagggattttaacatg
attgatctgaagttcaaggaggaagtgaaccattacagcaatgagattaacaaggcatgc
atgccttttggcctacacagacagttcccagagaacagcctgcagatgatggtgcagtcg
ggagccaaaggttcaactgtgaacacgatgcagatctcgtgcctgctgggccagattgaa
ctggaaggtcggagacccccgctgatggcgtctggcaagtcactgccctgctttgagcct
tatgagttcacccccagggctggtggctttgtcactggcaggttcctcaccggcatcaaa
cctcctgagttcttcttccactgcatggcaggacgagagggcctggtggacactgctgtg
aaaaccagccgctcaggctatctccaaaggtgcatcatcaagcacctagaggggctggtc
gtgcagtatgatctcacggtccgtgacagtgacggcagtgtggtgcagttcctgtatggg
gaggatggcctggacatccccaagacacagttcctgcagcccaagcagttccccttcctg
gccagcaactacgaggtgataatgaaatcacagcatctccatgaagttttatccagagca
gatcccaaaaaagctctccaccacttcagagctatcaaaaaatggcaaagcaagcacccc
aacaccctgctgagaagaggcgccttcttgagttattcccagaaaattcaggaagctgtg
aaagccctgaaacttgagagtgaaaaccgcaatggccgcagccctgggactcaggagatg
ctgaggatgtggtatgagttggatgaggaaagccgaaggaaataccagaagaaggcggcc
gcttgtcctgaccccagtctgtctgtctggcgtcctgacatctactttgcatcagtgtca
gaaacatttgaaacaaaggttgatgactacagtcaagagtgggcagctcaaacagagaag
agttatgagaaatcagagctttctctcgacaggttgaggaccttgctgcagctgaagtgg
cagcgctcactgtgtgagccgggcgaggctgtgggcctgctggctgcccagagcatcgga
gagccctccacccagatgaccctcaacaccttccactttgcaggcagaggcgagatgaac
gtcaccctgggcattccaaggttgcgggagattctcatggtggccagcgccaacatcaag
acacccatgatgagcgtgcccgtgctcaacaccaagaaagccctgaagagagtgaaaagc
ctgaagaagcaactcaccagggtgtgcttgggggaggtgttgcagaaaattgacgtccag
gagtccttctgtatggaagaaaaacagaacaaattccaggtgtaccagctgcggtttcag
ttcctgccacatgcatattaccagcaggagaagtgcctgagacccgaggacatcctgcgc
ttcatggaaacaagattctttaaacttctgatggaatccatcaaaaagaagaataataaa
gcatcagctttcaggaacgtaaacactcgaagagctacacagcgggatctggacaacgct
ggggagttggggaggagtcggggagagcaggagggtgatgaggaagaggaggggcacatt
gtggatgctgaagctgaggagggggacgccgatgcctctgatgccaaacgcaaggagaag
caggaggaggaggttgattatgagagtgaggaagaggaggagagggagggcgaggagaac
gacgatgaagacatgcaggaggaacgaaatccccacagggaaggtgctcgaaagacccaa
gagcaagatgaagaggtgggcttaggcactgaggaggacccgtcccttcccgccctcctg
acgcagccccggaaacccacccacagccaggagccccaggggcccgaggccatggagcgc
cgggtccaggctgtgcgtgagatccacccgttcatagatgactaccagtacgacaccgag
gagagcctgtggtgccaggtgacagtgaagctccctctgatgaagatcaactttgacatg
agctccctggtagtatctttggcccatggtgccgtcatctatgcgaccaagggcatcact
cggtgcctcctgaatgaaacaaccaacaataagaacgagaaggagcttgtgctaaacaca
gaaggaatcaacctcccagagctattcaagtatgcagaggtcctggatctgcgccgcctc
tactccaacgacatccacgccatagccaacacgtatggcattgaggccgcgctgcgggtg
atcgagaaggagatcaaggatgtgtttgccgtgtatggcatcgcggtcgaccctcgccat
ctctccctggttgctgattatatgtgcttcgagggtgtttacaagccactgaatcgcttt
gggatccggtcaaactcttccccgctacagcagatgacatttgaaaccagcttccagttt
ctgaagcaagccaccatgctgggatcccacgatgagctgaggtctccttctgcctgcctt
gtggtcgggaaggtcgtcaggggcgggacaggcctgttcgagctcaagcagcctctgaga
tag

DBGET integrated database retrieval system