KEGG   Homo sapiens (human): 3569
Entry
3569              CDS       T01001                                 
Symbol
IL6, BSF-2, BSF2, CDF, HGF, HSF, IFN-beta-2, IFNB2, IL-6
Name
(RefSeq) interleukin 6
  KO
K05405  interleukin 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa01523  Antifolate resistance
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04066  HIF-1 signaling pathway
hsa04068  FoxO signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04218  Cellular senescence
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa04657  IL-17 signaling pathway
hsa04659  Th17 cell differentiation
hsa04668  TNF signaling pathway
hsa04672  Intestinal immune network for IgA production
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04936  Alcoholic liver disease
hsa05010  Alzheimer disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05130  Pathogenic Escherichia coli infection
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05135  Yersinia infection
hsa05142  Chagas disease
hsa05143  African trypanosomiasis
hsa05144  Malaria
hsa05146  Amoebiasis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05171  Coronavirus disease - COVID-19
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05321  Inflammatory bowel disease
hsa05323  Rheumatoid arthritis
hsa05332  Graft-versus-host disease
hsa05410  Hypertrophic cardiomyopathy
hsa05417  Lipid and atherosclerosis
Network
nt06124  Chemokine signaling (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06171  SARS coronavirus 2 (SARS-CoV-2)
nt06219  JAK-STAT signaling
nt06224  CXCR signaling
nt06227  Nuclear receptor signaling
nt06240  Transcription
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
nt06360  Cushing syndrome
nt06460  Alzheimer disease
nt06466  Pathways of neurodegeneration
nt06517  TLR signaling
nt06518  JAK-STAT signaling
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N00139  FUS-DDIT3 fusion to CEBPB-mediated transcription
N00178  KSHV vGPCR to GNB/G-PI3K-JNK signaling pathway
N00317  AhR signaling pathway
N00400  HCMV US28 to GNB/G-PI3K-NFKB signaling pathway
N00435  TLR1/2/4-NFKB signaling pathway
N00994  AGE-RAGE signaling pathway
N00996  Mutation-caused aberrant Abeta to AGE-RAGE signaling pathway
N01306  AngII-AT1R-NOX2 signaling pathway
N01307  SARS-CoV-2 S to AngII-AT1R-NOX2 signaling pathway
N01556  IL6 family to Jak-STAT signaling pathway
N01566  TLR5-NFKB signaling pathway
Disease
H00084  Graft-versus-host disease
H00630  Rheumatoid arthritis
H01479  Castleman disease
H01672  Juvenile idiopathic arthritis
Drug target
Olokizumab: D12487
Pirfenidone: D01583<JP/US>
Pomalidomide: D08976<JP/US>
Siltuximab: D09669<US>
Sirukumab: D10080
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3569 (IL6)
   04668 TNF signaling pathway
    3569 (IL6)
   04066 HIF-1 signaling pathway
    3569 (IL6)
   04068 FoxO signaling pathway
    3569 (IL6)
   04151 PI3K-Akt signaling pathway
    3569 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3569 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    3569 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    3569 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3569 (IL6)
   04620 Toll-like receptor signaling pathway
    3569 (IL6)
   04621 NOD-like receptor signaling pathway
    3569 (IL6)
   04623 Cytosolic DNA-sensing pathway
    3569 (IL6)
   04625 C-type lectin receptor signaling pathway
    3569 (IL6)
   04659 Th17 cell differentiation
    3569 (IL6)
   04657 IL-17 signaling pathway
    3569 (IL6)
   04672 Intestinal immune network for IgA production
    3569 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3569 (IL6)
   05202 Transcriptional misregulation in cancer
    3569 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3569 (IL6)
   05161 Hepatitis B
    3569 (IL6)
   05171 Coronavirus disease - COVID-19
    3569 (IL6)
   05164 Influenza A
    3569 (IL6)
   05162 Measles
    3569 (IL6)
   05168 Herpes simplex virus 1 infection
    3569 (IL6)
   05163 Human cytomegalovirus infection
    3569 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3569 (IL6)
   05169 Epstein-Barr virus infection
    3569 (IL6)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    3569 (IL6)
   05132 Salmonella infection
    3569 (IL6)
   05135 Yersinia infection
    3569 (IL6)
   05133 Pertussis
    3569 (IL6)
   05134 Legionellosis
    3569 (IL6)
   05152 Tuberculosis
    3569 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    3569 (IL6)
   05144 Malaria
    3569 (IL6)
   05142 Chagas disease
    3569 (IL6)
   05143 African trypanosomiasis
    3569 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    3569 (IL6)
   05321 Inflammatory bowel disease
    3569 (IL6)
   05332 Graft-versus-host disease
    3569 (IL6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    3569 (IL6)
   05020 Prion disease
    3569 (IL6)
   05022 Pathways of neurodegeneration - multiple diseases
    3569 (IL6)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    3569 (IL6)
   05410 Hypertrophic cardiomyopathy
    3569 (IL6)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    3569 (IL6)
   04932 Non-alcoholic fatty liver disease
    3569 (IL6)
   04931 Insulin resistance
    3569 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    3569 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    3569 (IL6)
   01523 Antifolate resistance
    3569 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3569 (IL6)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   3569 (IL6)
SSDB
Motif
Pfam: IL6 IL11 IL23 Phage_int_SAM_1 GCSF
Other DBs
NCBI-GeneID: 3569
NCBI-ProteinID: NP_000591
OMIM: 147620
HGNC: 6018
Ensembl: ENSG00000136244
UniProt: P05231 Q75MH2 B4DVM1
Structure
Position
7:22727200..22731998
AA seq 212 aa
MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI
LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL
EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ
AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
NT seq 639 nt   +upstreamnt  +downstreamnt
atgaactccttctccacaagcgccttcggtccagttgccttctccctggggctgctcctg
gtgttgcctgctgccttccctgccccagtacccccaggagaagattccaaagatgtagcc
gccccacacagacagccactcacctcttcagaacgaattgacaaacaaattcggtacatc
ctcgacggcatctcagccctgagaaaggagacatgtaacaagagtaacatgtgtgaaagc
agcaaagaggcactggcagaaaacaacctgaaccttccaaagatggctgaaaaagatgga
tgcttccaatctggattcaatgaggagacttgcctggtgaaaatcatcactggtcttttg
gagtttgaggtatacctagagtacctccagaacagatttgagagtagtgaggaacaagcc
agagctgtgcagatgagtacaaaagtcctgatccagttcctgcagaaaaaggcaaagaat
ctagatgcaataaccacccctgacccaaccacaaatgccagcctgctgacgaagctgcag
gcacagaaccagtggctgcaggacatgacaactcatctcattctgcgcagctttaaggag
ttcctgcagtccagcctgagggctcttcggcaaatgtag

DBGET integrated database retrieval system