Entry |
|
Symbol |
CXCL8, GCP-1, GCP1, IL8, LECT, LUCT, LYNAP, MDNCF, MONAP, NAF, NAP-1, NAP1, SCYB8
|
Name |
(RefSeq) C-X-C motif chemokine ligand 8
|
KO |
|
Organism |
|
Pathway |
hsa04060 | Cytokine-cytokine receptor interaction |
hsa04061 | Viral protein interaction with cytokine and cytokine receptor |
hsa04072 | Phospholipase D signaling pathway |
hsa04620 | Toll-like receptor signaling pathway |
hsa04621 | NOD-like receptor signaling pathway |
hsa04622 | RIG-I-like receptor signaling pathway |
hsa04932 | Non-alcoholic fatty liver disease |
hsa04933 | AGE-RAGE signaling pathway in diabetic complications |
hsa05120 | Epithelial cell signaling in Helicobacter pylori infection |
hsa05130 | Pathogenic Escherichia coli infection |
hsa05163 | Human cytomegalovirus infection |
hsa05167 | Kaposi sarcoma-associated herpesvirus infection |
hsa05202 | Transcriptional misregulation in cancer |
|
Network |
nt06124 Chemokine signaling (viruses) nt06140 Transcription (viruses) nt06150 Cytokine-cytokine receptor interaction (viruses) nt06162 Hepatitis B virus (HBV) nt06164 Kaposi sarcoma-associated herpesvirus (KSHV) nt06167 Human cytomegalovirus (HCMV) nt06171 Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) nt06224 CXCR signaling nt06240 Transcription nt06263 Hepatocellular carcinoma |
Element |
N00140 | FUS-DDIT3 fusion to NFKB-mediated transcription |
N00152 | CXCR-GNB/G-ERK signaling pathway |
N00153 | CCR/CXCR-GNB/G-PI3K-RAC signaling pathway |
N00154 | CXCR-GNB/G-PI3K-AKT signaling pathway |
N00178 | KSHV vGPCR to GNB/G-PI3K-JNK signaling pathway |
N00400 | HCMV US28 to GNB/G-PI3K-NFKB signaling pathway |
N00402 | HCMV US28 to GNAQ-PLCB/G-calcineurin signaling pathway |
N00544 | HBV HBx to CREB-mediated transcription |
N01233 | CXCL1/5/6/8 to CXCR1 signaling |
N01234 | CXCL1/5/8 to KSHV vGPCR signaling |
N01238 | CXCL1/2/3/5/6/7/8 to CXCR2 signaling |
N01307 | SARS-CoV-2 S to AngII-AT1R-NOX2 signaling pathway |
|
Brite |
KEGG Orthology (KO) [BR:hsa00001]
09130 Environmental Information Processing
09132 Signal transduction
04064 NF-kappa B signaling pathway
3576 (CXCL8)
04072 Phospholipase D signaling pathway
3576 (CXCL8)
09133 Signaling molecules and interaction
04060 Cytokine-cytokine receptor interaction
3576 (CXCL8)
04061 Viral protein interaction with cytokine and cytokine receptor
3576 (CXCL8)
09140 Cellular Processes
09143 Cell growth and death
04218 Cellular senescence
3576 (CXCL8)
09150 Organismal Systems
09151 Immune system
04620 Toll-like receptor signaling pathway
3576 (CXCL8)
04621 NOD-like receptor signaling pathway
3576 (CXCL8)
04622 RIG-I-like receptor signaling pathway
3576 (CXCL8)
04657 IL-17 signaling pathway
3576 (CXCL8)
04062 Chemokine signaling pathway
3576 (CXCL8)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
3576 (CXCL8)
05202 Transcriptional misregulation in cancer
3576 (CXCL8)
09162 Cancer: specific types
05219 Bladder cancer
3576 (CXCL8)
09172 Infectious disease: viral
05161 Hepatitis B
3576 (CXCL8)
05171 Coronavirus disease - COVID-19
3576 (CXCL8)
05164 Influenza A
3576 (CXCL8)
05163 Human cytomegalovirus infection
3576 (CXCL8)
05167 Kaposi sarcoma-associated herpesvirus infection
3576 (CXCL8)
09171 Infectious disease: bacterial
05120 Epithelial cell signaling in Helicobacter pylori infection
3576 (CXCL8)
05130 Pathogenic Escherichia coli infection
3576 (CXCL8)
05132 Salmonella infection
3576 (CXCL8)
05131 Shigellosis
3576 (CXCL8)
05135 Yersinia infection
3576 (CXCL8)
05133 Pertussis
3576 (CXCL8)
05134 Legionellosis
3576 (CXCL8)
09174 Infectious disease: parasitic
05146 Amoebiasis
3576 (CXCL8)
05144 Malaria
3576 (CXCL8)
05142 Chagas disease
3576 (CXCL8)
09163 Immune disease
05323 Rheumatoid arthritis
3576 (CXCL8)
09166 Cardiovascular disease
05417 Lipid and atherosclerosis
3576 (CXCL8)
09167 Endocrine and metabolic disease
04936 Alcoholic liver disease
3576 (CXCL8)
04932 Non-alcoholic fatty liver disease
3576 (CXCL8)
04933 AGE-RAGE signaling pathway in diabetic complications
3576 (CXCL8)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04052 Cytokines and growth factors [BR:hsa04052]
3576 (CXCL8)
00536 Glycosaminoglycan binding proteins [BR:hsa00536]
3576 (CXCL8)
Cytokines and growth factors [BR:hsa04052]
Cytokines
Chemokines
3576 (CXCL8)
Glycosaminoglycan binding proteins [BR:hsa00536]
Heparan sulfate / Heparin
Chemokines
3576 (CXCL8)
|
SSDB |
|
Motif |
|
Other DBs |
|
Structure |
|
Position |
4:73740569..73743716
|
AA seq |
99 aa
MTSKLAVALLAAFLISAALCEGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPH
CANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS |
NT seq |
300 nt +upstreamnt +downstreamnt
atgacttccaagctggccgtggctctcttggcagccttcctgatttctgcagctctgtgt
gaaggtgcagttttgccaaggagtgctaaagaacttagatgtcagtgcataaagacatac
tccaaacctttccaccccaaatttatcaaagaactgagagtgattgagagtggaccacac
tgcgccaacacagaaattattgtaaagctttctgatggaagagagctctgtctggacccc
aaggaaaactgggtgcagagggttgtggagaagtttttgaagagggctgagaattcataa |