KEGG   Homo sapiens (human): 3661
Entry
3661              CDS       T01001                                 
Symbol
IRF3, IIAE7
Name
(RefSeq) interferon regulatory factor 3
  KO
K05411  interferon regulatory factor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04936  Alcoholic liver disease
hsa05131  Shigellosis
hsa05133  Pertussis
hsa05135  Yersinia infection
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05203  Viral carcinogenesis
hsa05417  Lipid and atherosclerosis
Network
nt06121  TLR signaling (viruses and bacteria)
nt06133  RLR signaling (viruses)
nt06134  CGAS-STING signaling (viruses and bacteria)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06221  TLR signaling
nt06263  Hepatocellular carcinoma
  Element
N00149  TLR3-IRF3 signaling pathway
N00161  KSHV vIRF1/2 to TLR3-IRF3 signaling pathway
N00346  HPV E6 to TLR-IRF3 signaling pathway
N00395  cGAS-STING signaling pathway
N00440  HIV Vpu/Vif/Vpr to cGAS-STING signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00470  EBV BGLF4 to RIG-I-like receptor signaling pathway
N00517  HCV NS3/4A to TLR3-IRF3 signaling pathway
N00553  TLR4-IRF3/7 signaling pathway
N00568  HSV US3 to IRF3 signaling pathway
N00686  MV N to RIG-I-IRF7/3 signaling pathway
N00687  MV V/C to RIG-I-IRF7/3 signaling pathway
N00729  IAV NS1 to RIG-I-like receptor signaling pathway
N01308  MDA5-IRF7/3 signaling pathway
N01319  SARS-CoV-2 nsp6 and ORF6 to RIG-I-IRF7/3 signaling pathway
N01320  SARS-CoV-2 nsp3 to RIG-I-IRF7/3 signaling pathway
Disease
H02536  Infection-induced acute encephalopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3661 (IRF3)
   04621 NOD-like receptor signaling pathway
    3661 (IRF3)
   04622 RIG-I-like receptor signaling pathway
    3661 (IRF3)
   04623 Cytosolic DNA-sensing pathway
    3661 (IRF3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    3661 (IRF3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3661 (IRF3)
   05161 Hepatitis B
    3661 (IRF3)
   05160 Hepatitis C
    3661 (IRF3)
   05171 Coronavirus disease - COVID-19
    3661 (IRF3)
   05164 Influenza A
    3661 (IRF3)
   05162 Measles
    3661 (IRF3)
   05168 Herpes simplex virus 1 infection
    3661 (IRF3)
   05163 Human cytomegalovirus infection
    3661 (IRF3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3661 (IRF3)
   05169 Epstein-Barr virus infection
    3661 (IRF3)
   05165 Human papillomavirus infection
    3661 (IRF3)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    3661 (IRF3)
   05135 Yersinia infection
    3661 (IRF3)
   05133 Pertussis
    3661 (IRF3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    3661 (IRF3)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    3661 (IRF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3661 (IRF3)
   04131 Membrane trafficking [BR:hsa04131]
    3661 (IRF3)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    3661 (IRF3)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    3661 (IRF3)
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 3661
NCBI-ProteinID: NP_001562
OMIM: 603734
HGNC: 6118
Ensembl: ENSG00000126456
Vega: OTTHUMG00000183287
Pharos: Q14653(Tbio)
UniProt: Q14653
Structure
Position
19:complement(49659572..49665857)
AA seq 427 aa
MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEA
TGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQP
DTSPDTNGGGSTSDTQEDILDELLGNMVLAPLPDPGPPSLAVAPEPCPQPLRSPSLDNPT
PFPNLGPSENPLKRLLVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPG
WPVTLPDPGMSLTDRGVMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELL
PNSGHGPDGEVPKDKEGGVFDLGPFIVDLITFTEGSGRSPRYALWFCVGESWPQDQPWTK
RLVMVKVVPTCLRALVEMARVGGASSLENTVDLHISNSHPLSLTSDQYKAYLQDLVEGMD
FQGPGES
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgggaaccccaaagccacggatcctgccctggctggtgtcgcagctggacctggggcaa
ctggagggcgtggcctgggtgaacaagagccgcacgcgcttccgcatcccttggaagcac
ggcctacggcaggatgcacagcaggaggatttcggaatcttccaggcctgggccgaggcc
actggtgcatatgttcccgggagggataagccagacctgccaacctggaagaggaatttc
cgctctgccctcaaccgcaaagaagggttgcgtttagcagaggaccggagcaaggaccct
cacgacccacataaaatctacgagtttgtgaactcaggagttggggacttttcccagcca
gacacctctccggacaccaatggtggaggcagtacttctgatacccaggaagacattctg
gatgagttactgggtaacatggtgttggccccactcccagatccgggacccccaagcctg
gctgtagcccctgagccctgccctcagcccctgcggagccccagcttggacaatcccact
cccttcccaaacctggggccctctgagaacccactgaagcggctgttggtgccgggggaa
gagtgggagttcgaggtgacagccttctaccggggccgccaagtcttccagcagaccatc
tcctgcccggagggcctgcggctggtggggtccgaagtgggagacaggacgctgcctgga
tggccagtcacactgccagaccctggcatgtccctgacagacaggggagtgatgagctac
gtgaggcatgtgctgagctgcctgggtgggggactggctctctggcgggccgggcagtgg
ctctgggcccagcggctggggcactgccacacatactgggcagtgagcgaggagctgctc
cccaacagcgggcatgggcctgatggcgaggtccccaaggacaaggaaggaggcgtgttt
gacctggggcccttcattgtagatctgattaccttcacggaaggaagcggacgctcacca
cgctatgccctctggttctgtgtgggggagtcatggccccaggaccagccgtggaccaag
aggctcgtgatggtcaaggttgtgcccacgtgcctcagggccttggtagaaatggcccgg
gtagggggtgcctcctccctggagaatactgtggacctgcacatttccaacagccaccca
ctctccctcacctccgaccagtacaaggcctacctgcaggacttggtggagggcatggat
ttccagggccctggggagagctga

DBGET integrated database retrieval system