KEGG   Homo sapiens (human): 3810
Entry
3810              CDS       T01001                                 

Gene name
KIR2DS5, CD158G, NKAT9
Definition
(RefSeq) killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 5
  KO
K07982  killer cell immunoglobulin-like receptor 2DS
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3810 (KIR2DS5)
   04612 Antigen processing and presentation
    3810 (KIR2DS5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    3810 (KIR2DS5)
CD molecules [BR:hsa04090]
 Proteins
  3810 (KIR2DS5)
SSDB
Motif
Pfam: ig Ig_3 Ig_2 Ig_4
Other DBs
NCBI-GeneID: 3810
NCBI-ProteinID: NP_055328
OMIM: 604956
HGNC: 6337
UniProt: Q14953 A0A7D4Y677
Position
19q13.4
AA seq 304 aa
MSLMVISMACVAFFLLQGAWPHEGFRRKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLL
HREGTFNHTLRLIGEHIDGVSKGNFSIGRMTQDLAGTYRCYGSVTHSPYQLSAPSDPLDI
VITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNRT
FQADFPLDPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNSSNSWPSPTEPSSETGN
PRHLHVLIGTSVVKLPFTILLFFLLHRWCSNKKNASVMDQGPAGNRTVNREDSDEQDHQE
VSYA
NT seq 915 nt   +upstreamnt  +downstreamnt
atgtcgctcatggtcatcagcatggcgtgtgttgcgttcttcttgctgcagggggcctgg
ccacatgagggattccgcagaaaaccttccctcctggcccacccaggtcccctggtgaaa
tcagaagagacagtcatcctgcaatgttggtcagatgtcatgtttgagcacttccttctg
cacagagaggggacgtttaaccacactttgcgcctcattggagagcacattgatggggtc
tccaagggcaacttctccatcggtcgcatgacacaagacctggcagggacctacagatgc
tacggttctgttactcactccccctatcagttgtcagcgcccagtgaccctctggacatc
gtgatcacaggtctatatgagaaaccttctctctcagcccagccgggccccacggttctg
gcaggagagagcgtgaccttgtcctgcagctcccggagctcctatgacatgtaccatcta
tccagggaaggggaggcccatgaacgtaggctccctgcagggcccaaggtcaacagaaca
ttccaggccgactttcctctggaccctgccacccacggagggacctacagatgcttcggc
tctttccgtgactctccatacgagtggtcaaagtcaagtgacccactgcttgtttctgtc
acaggaaactcttcaaatagttggccttcacccactgaaccaagctccgaaaccggtaac
cccagacacctacacgttctgattgggacctcagtggtcaaactccctttcaccatcctc
ctcttctttctccttcatcgctggtgctccaacaaaaaaaatgcatctgtaatggaccaa
gggcctgcggggaacagaacagtgaacagggaggattctgatgaacaggaccatcaggag
gtgtcatacgcataa

DBGET integrated database retrieval system