KEGG   Homo sapiens (human): 4018
Entry
4018              CDS       T01001                                 
Symbol
LPA, AK38, APOA, LP
Name
(RefSeq) lipoprotein(a)
  KO
K09644  apolipoprotein(a) [EC:3.4.21.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04979  Cholesterol metabolism
Drug target
Muvalaplin: D12460
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04979 Cholesterol metabolism
    4018 (LPA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    4018 (LPA)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-
     4018 (LPA)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   4018 (LPA)
SSDB
Motif
Pfam: Kringle Trypsin Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 4018
NCBI-ProteinID: NP_005568
OMIM: 152200
HGNC: 6667
Ensembl: ENSG00000198670
Position
6:complement(160531482..160664275)
AA seq 2040 aa
MEHKEVVLLLLLFLKSAAPEQSHVVQDCYHGDGQSYRGTYSTTVTGRTCQAWSSMTPHQH
NRTTENYPNAGLIMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTP
VPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEY
YPNAGLIMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEA
PSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGL
IMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAP
TEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCR
NPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPG
VQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVA
APYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYH
GNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVAAPYCYT
RDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSY
RGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVAAPYCYTRDPGVR
WEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYST
TVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDPVAAPYCYTRDPSVRWEYCNL
TQCSDAEGTAVAPPTITPIPSLEAPSEQAPTEQRPGVQECYHGNGQSYQGTYFITVTGRT
CQAWSSMTPHSHSRTPAYYPNAGLIKNYCRNPDPVAAPWCYTTDPSVRWEYCNLTRCSDA
EWTAFVPPNVILAPSLEAFFEQALTEETPGVQDCYYHYGQSYRGTYSTTVTGRTCQAWSS
MTPHQHSRTPENYPNAGLTRNYCRNPDAEIRPWCYTMDPSVRWEYCNLTQCLVTESSVLA
TLTVVPDPSTEASSEEAPTEQSPGVQDCYHGDGQSYRGSFSTTVTGRTCQSWSSMTPHWH
QRTTEYYPNGGLTRNYCRNPDAEISPWCYTMDPNVRWEYCNLTQCPVTESSVLATSTAVS
EQAPTEQSPTVQDCYHGDGQSYRGSFSTTVTGRTCQSWSSMTPHWHQRTTEYYPNGGLTR
NYCRNPDAEIRPWCYTMDPSVRWEYCNLTQCPVMESTLLTTPTVVPVPSTELPSEEAPTE
NSTGVQDCYRGDGQSYRGTLSTTITGRTCQSWSSMTPHWHRRIPLYYPNAGLTRNYCRNP
DAEIRPWCYTMDPSVRWEYCNLTRCPVTESSVLTTPTVAPVPSTEAPSEQAPPEKSPVVQ
DCYHGDGRSYRGISSTTVTGRTCQSWSSMIPHWHQRTPENYPNAGLTENYCRNPDSGKQP
WCYTTDPCVRWEYCNLTQCSETESGVLETPTVVPVPSMEAHSEAAPTEQTPVVRQCYHGN
GQSYRGTFSTTVTGRTCQSWSSMTPHRHQRTPENYPNDGLTMNYCRNPDADTGPWCFTMD
PSIRWEYCNLTRCSDTEGTVVAPPTVIQVPSLGPPSEQDCMFGNGKGYRGKKATTVTGTP
CQEWAAQEPHRHSTFIPGTNKWAGLEKNYCRNPDGDINGPWCYTMNPRKLFDYCDIPLCA
SSSFDCGKPQVEPKKCPGSIVGGCVAHPHSWPWQVSLRTRFGKHFCGGTLISPEWVLTAA
HCLKKSSRPSSYKVILGAHQEVNLESHVQEIEVSRLFLEPTQADIALLKLSRPAVITDKV
MPACLPSPDYMVTARTECYITGWGETQGTFGTGLLKEAQLLVIENEVCNHYKYICAEHLA
RGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYARVSRFVTWIEGMMRNN
NT seq 6123 nt   +upstreamnt  +downstreamnt
atggaacataaggaagtggttcttctacttcttttatttctgaaatcagcagcacctgag
caaagccatgtggtccaggattgctaccatggtgatggacagagttatcgaggcacgtac
tccaccactgtcacaggaaggacctgccaagcttggtcatctatgacaccacatcaacat
aataggaccacagaaaactacccaaatgctggcttgatcatgaactactgcaggaatcca
gatgctgtggcagctccttattgttatacgagggatcccggtgtcaggtgggagtactgc
aacctgacgcaatgctcagacgcagaagggactgccgtcgcgcctccgactgttaccccg
gttccaagcctagaggctccttccgaacaagcaccgactgagcaaaggcctggggtgcag
gagtgctaccatggtaatggacagagttatcgaggcacatactccaccactgtcacagga
agaacctgccaagcttggtcatctatgacaccacactcgcatagtcggaccccagaatac
tacccaaatgctggcttgatcatgaactactgcaggaatccagatgctgtggcagctcct
tattgttatacgagggatcccggtgtcaggtgggagtactgcaacctgacgcaatgctca
gacgcagaagggactgccgtcgcgcctccgactgttaccccggttccaagcctagaggct
ccttccgaacaagcaccgactgagcaaaggcctggggtgcaggagtgctaccatggtaat
ggacagagttatcgaggcacatactccaccactgtcacaggaagaacctgccaagcttgg
tcatctatgacaccacactcgcatagtcggaccccagaatactacccaaatgctggcttg
atcatgaactactgcaggaatccagatgctgtggcagctccttattgttatacgagggat
cccggtgtcaggtgggagtactgcaacctgacgcaatgctcagacgcagaagggactgcc
gtcgcgcctccgactgttaccccggttccaagcctagaggctccttccgaacaagcaccg
actgagcagaggcctggggtgcaggagtgctaccacggtaatggacagagttatcgaggc
acatactccaccactgtcactggaagaacctgccaagcttggtcatctatgacaccacac
tcgcatagtcggaccccagaatactacccaaatgctggcttgatcatgaactactgcagg
aatccagatgctgtggcagctccttattgttatacgagggatcccggtgtcaggtgggag
tactgcaacctgacgcaatgctcagacgcagaagggactgccgtcgcgcctccgactgtt
accccggttccaagcctagaggctccttccgaacaagcaccgactgagcaaaggcctggg
gtgcaggagtgctaccatggtaatggacagagttatcgaggcacatactccaccactgtc
acaggaagaacctgccaagcttggtcatctatgacaccacactcgcatagtcggacccca
gaatactacccaaatgctggcttgatcatgaactactgcaggaatccagatgctgtggca
gctccttattgttatacgagggatcccggtgtcaggtgggagtactgcaacctgacgcaa
tgctcagacgcagaagggactgccgtcgcgcctccgactgttaccccggttccaagccta
gaggctccttccgaacaagcaccgactgagcaaaggcctggggtgcaggagtgctaccat
ggtaatggacagagttatcgaggcacatactccaccactgtcacaggaagaacctgccaa
gcttggtcatctatgacaccacactcgcatagtcggaccccagaatactacccaaatgct
ggcttgatcatgaactactgcaggaatccagatgctgtggcagctccttattgttatacg
agggatcccggtgtcaggtgggagtactgcaacctgacgcaatgctcagacgcagaaggg
actgccgtcgcgcctccgactgttaccccggttccaagcctagaggctccttccgaacaa
gcaccgactgagcaaaggcctggggtgcaggagtgctaccatggtaatggacagagttat
cgaggcacatactccaccactgtcacaggaagaacctgccaagcttggtcatctatgaca
ccacactcgcatagtcggaccccagaatactacccaaatgctggcttgatcatgaactac
tgcaggaatccagatgctgtggcagctccttattgttatacgagggatcccggtgtcagg
tgggagtactgcaacctgacgcaatgctcagacgcagaagggactgccgtcgcgcctccg
actgttaccccggttccaagcctagaggctccttccgaacaagcaccgactgagcagagg
cctggggtgcaggagtgctaccacggtaatggacagagttatcgaggcacatactccacc
actgtcactggaagaacctgccaagcttggtcatctatgacaccacactcgcatagtcgg
accccagaatactacccaaatgctggcttgatcatgaactactgcaggaatccagatcct
gtggcagccccttattgttatacgagggatcccagtgtcaggtgggagtactgcaacctg
acacaatgctcagacgcagaagggactgccgtcgcgcctccaactattaccccgattcca
agcctagaggctccttctgaacaagcaccaactgagcaaaggcctggggtgcaggagtgc
taccacggaaatggacagagttatcaaggcacatacttcattactgtcacaggaagaacc
tgccaagcttggtcatctatgacaccacactcgcatagtcggaccccagcatactaccca
aatgctggcttgatcaagaactactgccgaaatccagatcctgtggcagccccttggtgt
tatacaacagatcccagtgtcaggtgggagtactgcaacctgacacgatgctcagatgca
gaatggactgccttcgtccctccgaatgttattctggctccaagcctagaggcttttttt
gaacaagcactgactgaggaaacccccggggtacaggactgctactaccattatggacag
agttaccgaggcacatactccaccactgtcacaggaagaacttgccaagcttggtcatct
atgacaccacaccagcatagtcggaccccagaaaactacccaaatgctggcctgaccagg
aactactgcaggaatccagatgctgagattcgcccttggtgttacaccatggatcccagt
gtcaggtgggagtactgcaacctgacacaatgcctggtgacagaatcaagtgtccttgca
actctcacggtggtcccagatccaagcacagaggcttcttctgaagaagcaccaacggag
caaagccccggggtccaggattgctaccatggtgatggacagagttatcgaggctcattc
tctaccactgtcacaggaaggacatgtcagtcttggtcctctatgacaccacactggcat
cagaggacaacagaatattatccaaatggtggcctgaccaggaactactgcaggaatcca
gatgctgagattagtccttggtgttataccatggatcccaatgtcagatgggagtactgc
aacctgacacaatgtccagtgacagaatcaagtgtccttgcgacgtccacggctgtttct
gaacaagcaccaacggagcaaagccccacagtccaggactgctaccatggtgatggacag
agttatcgaggctcattctccaccactgttacaggaaggacatgtcagtcttggtcctct
atgacaccacactggcatcagagaaccacagaatactacccaaatggtggcctgaccagg
aactactgcaggaatccagatgctgagattcgcccttggtgttataccatggatcccagt
gtcagatgggagtactgcaacctgacgcaatgtccagtgatggaatcaactctcctcaca
actcccacggtggtcccagttccaagcacagagcttccttctgaagaagcaccaactgaa
aacagcactggggtccaggactgctaccgaggtgatggacagagttatcgaggcacactc
tccaccactatcacaggaagaacatgtcagtcttggtcgtctatgacaccacattggcat
cggaggatcccattatactatccaaatgctggcctgaccaggaactactgcaggaatcca
gatgctgagattcgcccttggtgttacaccatggatcccagtgtcaggtgggagtactgc
aacctgacacgatgtccagtgacagaatcgagtgtcctcacaactcccacagtggccccg
gttccaagcacagaggctccttctgaacaagcaccacctgagaaaagccctgtggtccag
gattgctaccatggtgatggacggagttatcgaggcatatcctccaccactgtcacagga
aggacctgtcaatcttggtcatctatgataccacactggcatcagaggaccccagaaaac
tacccaaatgctggcctgaccgagaactactgcaggaatccagattctgggaaacaaccc
tggtgttacacaaccgatccgtgtgtgaggtgggagtactgcaatctgacacaatgctca
gaaacagaatcaggtgtcctagagactcccactgttgttccagttccaagcatggaggct
cattctgaagcagcaccaactgagcaaacccctgtggtccggcagtgctaccatggtaat
ggccagagttatcgaggcacattctccaccactgtcacaggaaggacatgtcaatcttgg
tcatccatgacaccacaccggcatcagaggaccccagaaaactacccaaatgatggcctg
acaatgaactactgcaggaatccagatgccgatacaggcccttggtgttttaccatggac
cccagcatcaggtgggagtactgcaacctgacgcgatgctcagacacagaagggactgtg
gtcgctcctccgactgtcatccaggttccaagcctagggcctccttctgaacaagactgt
atgtttgggaatgggaaaggataccggggcaagaaggcaaccactgttactgggacgcca
tgccaggaatgggctgcccaggagccccatagacacagcacgttcattccagggacaaat
aaatgggcaggtctggaaaaaaattactgccgtaaccctgatggtgacatcaatggtccc
tggtgctacacaatgaatccaagaaaactttttgactactgtgatatccctctctgtgca
tcctcttcatttgattgtgggaagcctcaagtggagccgaagaaatgtcctggaagcatt
gtaggggggtgtgtggcccacccacattcctggccctggcaagtcagtctcagaacaagg
tttggaaagcacttctgtggaggcaccttaatatccccagagtgggtgctgactgctgct
cactgcttgaagaagtcctcaaggccttcatcctacaaggtcatcctgggtgcacaccaa
gaagtgaacctcgaatctcatgttcaggaaatagaagtgtctaggctgttcttggagccc
acacaagcagatattgccttgctaaagctaagcaggcctgccgtcatcactgacaaagta
atgccagcttgtctgccatccccagactacatggtcaccgccaggactgaatgttacatc
actggctggggagaaacccaaggtacctttgggactggccttctcaaggaagcccagctc
cttgttattgagaatgaagtgtgcaatcactataagtatatttgtgctgagcatttggcc
agaggcactgacagttgccagggtgacagtggagggcctctggtttgcttcgagaaggac
aaatacattttacaaggagtcacttcttggggtcttggctgtgcacgccccaataagcct
ggtgtctatgctcgtgtttcaaggtttgttacttggattgagggaatgatgagaaataat
taa

DBGET integrated database retrieval system