KEGG   Homo sapiens (human): 435
Entry
435               CDS       T01001                                 
Symbol
ASL, ASAL
Name
(RefSeq) argininosuccinate lyase
  KO
K01755  argininosuccinate lyase [EC:4.3.2.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00220  Arginine biosynthesis
hsa00250  Alanine, aspartate and glutamate metabolism
hsa01100  Metabolic pathways
hsa01230  Biosynthesis of amino acids
Module
hsa_M00029  Urea cycle
hsa_M00844  Arginine biosynthesis, ornithine => arginine
Network
nt06010  Urea cycle
  Element
N00593  Urea cycle
Disease
H01028  Argininosuccinic aciduria
H01398  Primary hyperammonemic disorders (Urea cycle disorders)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    435 (ASL)
   00220 Arginine biosynthesis
    435 (ASL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    435 (ASL)
Enzymes [BR:hsa01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.1  argininosuccinate lyase
     435 (ASL)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   435 (ASL)
SSDB
Motif
Pfam: Lyase_1 ASL_C2 T4SS_CagC
Other DBs
NCBI-GeneID: 435
NCBI-ProteinID: NP_000039
OMIM: 608310
HGNC: 746
Ensembl: ENSG00000126522
Pharos: P04424(Tbio)
UniProt: P04424 A0A024RDL8
Structure
Position
7:66075819..66093576
AA seq 464 aa
MASESGKLWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEM
DQILHGLDKVAEEWAQGTFKLNSNDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTD
LRLWMRQTCSTLSGLLWELIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVAL
TRDSERLLEVRKRINVLPLGSGAIAGNPLGVDRELLRAELNFGAITLNSMDATSERDFVA
EFLFWASLCMTHLSRMAEDLILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKA
GRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVISTLQIHQENM
GQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLF
SGDVICVWDYGHSVEQYGALGGTARSSVDWQIRQVRALLQAQQA
NT seq 1395 nt   +upstreamnt  +downstreamnt
atggcctcggagagtgggaagctttggggtggccggtttgtgggtgcagtggaccccatc
atggagaagttcaacgcgtccattgcctacgaccggcacctttgggaggtggatgttcaa
ggcagcaaagcctacagcaggggcctggagaaggcagggctcctcaccaaggccgagatg
gaccagatactccatggcctagacaaggtggctgaggagtgggcccagggcaccttcaaa
ctgaactccaatgatgaggacatccacacagccaatgagcgccgcctgaaggagctcatt
ggtgcaacggcagggaagctgcacacgggacggagccggaatgaccaggtggtcacagac
ctcaggctgtggatgcggcagacctgctccacgctctcgggcctcctctgggagctcatt
aggaccatggtggatcgggcagaggcggaacgtgatgttctcttcccggggtacacccat
ttgcagagggcccagcccatccgctggagccactggattctgagccacgccgtggcactg
acccgagactctgagcggctgctggaggtgcggaagcggatcaatgtcctgcccctgggg
agtggggccattgcaggcaatcccctgggtgtggaccgagagctgctccgagcagaactc
aactttggggccatcactctcaacagcatggatgccactagtgagcgggactttgtggcc
gagttcctgttctgggcttcgctgtgcatgacccatctcagcaggatggccgaggacctc
atcctctactgcaccaaggaattcagcttcgtgcagctctcagatgcctacagcacggga
agcagcctgatgccccagaagaaaaaccccgacagtttggagctgatccggagcaaggct
gggcgtgtgtttgggcggtgtgccgggctcctgatgaccctcaagggacttcccagcacc
tacaacaaagacttacaggaggacaaggaagctgtgtttgaagtgtcagacactatgagt
gccgtgctccaggtggccactggcgtcatctctacgctgcagattcaccaagagaacatg
ggacaggctctcagccccgacatgctggccactgaccttgcctattacctggtccgcaaa
gggatgccattccgccaggcccacgaggcctccgggaaagctgtgttcatggccgagacc
aagggggtcgccctcaaccagctgtcactgcaggagctgcagaccatcagccccctgttc
tcgggcgacgtgatctgcgtgtgggactacgggcacagtgtggagcagtatggtgccctg
ggcggcactgcgcgctccagcgtcgactggcagatccgccaggtgcgggcgctactgcag
gcacagcaggcctag

DBGET integrated database retrieval system