KEGG   Homo sapiens (human): 4862
Entry
4862              CDS       T01001                                 
Symbol
NPAS2, MOP4, PASD4, bHLHe9
Name
(RefSeq) neuronal PAS domain protein 2
  KO
K09026  neuronal PAS domain-containing protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    4862 (NPAS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4862 (NPAS2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    4862 (NPAS2)
SSDB
Motif
Pfam: PAS_11 PAS_3 PAS HLH PAS_9
Other DBs
NCBI-GeneID: 4862
NCBI-ProteinID: NP_002509
OMIM: 603347
HGNC: 7895
Ensembl: ENSG00000170485
Pharos: Q99743(Tbio)
UniProt: Q99743 A2I2P5
Position
2:100818723..100996829
AA seq 824 aa
MDEDEKDRAKRASRNKSEKKRRDQFNVLIKELSSMLPGNTRKMDKTTVLEKVIGFLQKHN
EVSAQTEICDIQQDWKPSFLSNEEFTQLMLEALDGFIIAVTTDGSIIYVSDSITPLLGHL
PSDVMDQNLLNFLPEQEHSEVYKILSSHMLVTDSPSPEYLKSDSDLEFYCHLLRGSLNPK
EFPTYEYIKFVGNFRSYNNVPSPSCNGFDNTLSRPCRVPLGKEVCFIATVRLATPQFLKE
MCIVDEPLEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHIDDLELLARCH
QHLMQFGKGKSCCYRFLTKGQQWIWLQTHYYITYHQWNSKPEFIVCTHSVVSYADVRVER
RQELALEDPPSEALHSSALKDKGSSLEPRQHFNTLDVGASGLNTSHSPSASSRSSHKSSH
TAMSEPTSTPTKLMAEASTPALPRSATLPQELPVPGLSQAATMPAPLPSPSSCDLTQQLL
PQTVLQSTPAPMAQFSAQFSMFQTIKDQLEQRTRILQANIRWQQEELHKIQEQLCLVQDS
NVQMFLQQPAVSLSFSSTQRPEAQQQLQQRSAAVTQPQLGAGPQLPGQISSAQVTSQHLL
RESSVISTQGPKPMRSSQLMQSSGRSGSSLVSPFSSATAALPPSLNLTTPASTSQDASQC
QPSPDFSHDRQLRLLLSQPIQPMMPGSCDARQPSEVSRTGRQVKYAQSQTVFQNPDAHPA
NSSSAPMPVLLMGQAVLHPSFPASQPSPLQPAQARQQPPQHYLQVQAPTSLHSEQQDSLL
LSTYSQQPGTLGYPQPPPAQPQPLRPPRRVSSLSESSGLQQPPR
NT seq 2475 nt   +upstreamnt  +downstreamnt
atggatgaagatgagaaagacagagccaagagagcttctcgaaacaagtctgagaagaag
cgtcgggaccagttcaatgttctcatcaaagagctcagttccatgctccctggcaacacg
cggaaaatggacaaaaccaccgtgttggaaaaggtcatcggatttttgcagaaacacaat
gaagtctcagcgcaaacggaaatctgtgacattcagcaagactggaagccttcattcctc
agtaatgaagaattcacccagctgatgttggaggcattagatggcttcattatcgcagtg
acaacagacggcagcatcatctatgtctctgacagtatcacgcctctccttgggcattta
ccgtcggatgtcatggatcagaatttgttaaatttcctcccagaacaagaacattcagaa
gtttataaaatcctttcttcccatatgcttgtgacggattccccctccccagaatactta
aaatctgacagcgatttagagttttattgccatcttctcagaggcagcttgaacccaaag
gaatttccaacttatgaatacataaaatttgtaggaaattttcgctcttacaacaatgtg
cctagcccctcctgtaatggttttgacaacaccctttcaagaccttgccgggtgccacta
ggaaaggaggtttgcttcattgccaccgttcgtctggcaacaccacaattcttaaaggaa
atgtgcatagttgacgaacctttagaggaattcacttcaaggcatagcttggaatggaaa
tttttatttctggatcacagagcacctccaatcataggatacctgccttttgaagtgctg
ggaacctcaggctatgactactaccacattgatgacctggagctcctggccaggtgtcac
cagcacctgatgcagtttggcaaagggaagtcgtgttgctaccggtttctgaccaaaggt
cagcagtggatctggctgcagactcactactacatcacctaccatcagtggaactccaag
cccgagttcatcgtgtgcacacactcggtggtcagttacgcagatgtccgggtggaaagg
aggcaggagctggctctggaagacccgccatccgaggccctccactcctcagcactaaag
gacaagggctcaagcctggaacctcggcagcactttaacacactcgacgtgggtgcctcg
ggccttaataccagtcattcgccatcggcgtcctcaagaagttcccacaaatcctcgcac
acagccatgtcagaacccacctccactcccaccaagctgatggcagaggccagcaccccg
gctttgccaagatcagccaccctgccccaagagttacctgtccccgggctcagccaggca
gccaccatgccggcccctctgccttccccatcgtcctgcgacctcacacagcagctcctg
cctcagaccgttctgcagagcacgcccgctcccatggcacagttttcggcacagttcagc
atgttccagaccatcaaagaccagctagagcagcggacgcggatcctgcaggccaatatc
cggtggcaacaggaagagctccacaagatccaggagcagctctgcctggtccaggactcc
aacgtccagatgttcctgcagcagccagctgtatccctgagcttcagcagcacccagcga
cctgaggctcagcagcagctacagcaaaggtcagctgcagtgactcagccccagctcggg
gcgggcccccaacttccagggcagatctcctctgcccaggtcacaagccagcacctgctc
agagaatcaagtgtgatatcaacccagggtccaaagccaatgagaagctcacagctaatg
cagagcagcggccgctctggaagcagcctagtgtccccgttcagcagcgccacagctgcg
ctcccgccaagtctgaatctgaccacacctgcttccacctcccaggatgccagccagtgc
cagcccagcccagacttcagccatgatcggcagctcaggctgttgctgagccagcccatc
cagcccatgatgcccgggtcctgtgacgcaaggcagccctcggaagtcagcaggacggga
cggcaagtcaagtacgcccagagccagaccgtgtttcaaaatccagacgcacaccccgcc
aacagcagcagcgccccgatgcccgtcctgctgatggggcaggcggtgctccaccccagc
ttccctgcctcccaaccatcgcccctgcagcctgcacaggcccggcagcagccaccgcag
cactacctgcaggtacaggcaccaacctctttgcacagtgagcagcaggactcgctactt
ctctccacctactcacaacagccagggaccctgggctacccccaaccacccccagcacag
ccccagcccctacgtcctccccgaagggtcagcagtctgtctgagtcgtcaggcctccag
cagccgccccgataa

KEGG   Homo sapiens (human): 9575
Entry
9575              CDS       T01001                                 
Symbol
CLOCK, KAT13D, bHLHe8
Name
(RefSeq) clock circadian regulator
  KO
K02223  circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04710  Circadian rhythm
hsa04728  Dopaminergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    9575 (CLOCK)
  09159 Environmental adaptation
   04710 Circadian rhythm
    9575 (CLOCK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    9575 (CLOCK)
   03036 Chromosome and associated proteins [BR:hsa03036]
    9575 (CLOCK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     9575 (CLOCK)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    9575 (CLOCK)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    9575 (CLOCK)
SSDB
Motif
Pfam: PAS_11 PAS_3 HLH PAS PAS_9 DUF6080
Other DBs
NCBI-GeneID: 9575
NCBI-ProteinID: NP_001254772
OMIM: 601851
HGNC: 2082
Ensembl: ENSG00000134852
Pharos: O15516(Tbio)
UniProt: O15516 Q3ZCT4
Structure
Position
4:complement(55427903..55546909)
AA seq 846 aa
MLFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSM
LPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDG
FFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSL
TPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVKFIGNFKSLNSVSSSAHNGFEGTIQRT
HRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYL
PFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYH
QWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPETAADKSQDSGSDNRINTVSLKEA
LERFDHSPTPSASSRSSRKSSHTAVSDPSSTPTKIPTDTSTPPRQHLPAHEKMVQRRSSF
SSQSINSQSVGSSLTQPVMSQATNLPIPQGMSQFQFSAQLGAMQHLKDQLEQRTRMIEAN
IHRQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSSNIQQLAPINMQGQ
VVPTNQIQSGMNTGHIGTTQHMIQQQTLQSTSTQSQQNVLSGHSQQTSLPSQTQSTLTAP
LYNTMVISQPAAGSMVQIPSSMPQNSTQSAAVTTFTQDRQIRFSQGQQLVTKLVTAPVAC
GAVMVPSTMLMGQVVTAYPTFATQQQQSQTLSVTQQQQQQSSQEQQLTSVQQPSQAQLTQ
PPQQFLQTSRLLHGNPSTQLILSAAFPLQQSTFPQSHHQQHQSQQQQQLSRHRTDSLPDP
SKVQPQ
NT seq 2541 nt   +upstreamnt  +downstreamnt
atgttgtttaccgtaagctgtagtaaaatgagctcgattgttgacagagatgacagtagt
atttttgatgggttggtggaagaagatgacaaggacaaagcgaaaagagtatctagaaac
aaatctgaaaagaaacgtagagatcaatttaatgttctcattaaagaactgggatccatg
cttcctggtaatgctagaaagatggacaaatctactgttctgcagaaaagcattgatttt
ttacgaaaacataaagaaatcactgcacagtcagatgctagtgaaattcgacaggactgg
aaacctacattccttagtaatgaagagtttacacaattaatgttagaggctcttgatggt
ttttttttagcaatcatgacagatggaagcataatatatgtgtctgagagtgtaacttca
ttacttgaacatttaccatctgatcttgtggatcaaagtatatttaattttatcccagaa
ggggaacattcagaggtttataaaatactctctactcatctgctggaaagtgattcatta
accccagaatatttaaaatcaaaaaatcagttagaattctgttgtcacatgctgcgagga
acaatagacccaaaggagccatctacctatgaatatgtaaaatttataggaaatttcaaa
tctttaaacagtgtatcctcttcagcacacaatggttttgaaggaactatacaacgcaca
cataggccatcttatgaagatagagtttgttttgtagctactgtcaggttagctacacct
cagttcatcaaggaaatgtgcactgttgaagaacccaatgaagagtttacatctagacat
agtttagaatggaagtttctgtttctagatcacagggcaccacccataatagggtatttg
ccatttgaagttctgggaacatcaggctatgattactatcatgtggatgacctagaaaat
ttggcaaaatgtcatgagcacttaatgcaatatgggaaaggcaaatcatgttattatagg
ttcctgactaaggggcaacagtggatttggcttcagactcattattatatcacttaccat
cagtggaattcaaggccagagtttattgtttgtactcacactgtagtaagttatgcagaa
gttagggctgaaagacgacgagaacttggcattgaagagtctcttcctgagacagctgct
gacaaaagccaagattctgggtcagataatcgtataaacacagtcagtctcaaggaagca
ttggaaaggtttgatcacagcccaaccccttctgcctcttctcggagttcaagaaaatca
tctcacacggccgtctcagacccttcctcaacaccaaccaagatcccgacggatacgagc
actccacccaggcagcatttaccagctcatgagaagatggtgcaaagaaggtcatcattt
agtagtcagtccataaattcccagtctgttggttcatcattaacacagccagtgatgtct
caagctacaaatttaccaattccacaaggcatgtcccagtttcagttttcagctcaatta
ggagccatgcaacatctgaaagaccaattggaacaacggacacgcatgatagaagcaaat
attcatcggcaacaagaagaactaagaaaaattcaagaacaacttcagatggtccatggt
caggggctgcagatgtttttgcaacaatcaaatcctgggttgaattttggttccgttcaa
ctttcttctggaaattcatctaatatccagcaacttgcacctataaatatgcaaggccaa
gttgttcctactaaccagattcaaagtggaatgaatactggacacattggcacaactcag
cacatgatacaacaacagactttacagagtacatcaactcagagtcaacaaaatgtactg
agtgggcacagtcagcaaacatctctacccagtcagacacagagcactcttacagcccca
ctgtataacactatggtgatttctcagcctgcagccggaagcatggtccagattccatct
agtatgccacaaaacagcacccagagtgctgcagtaactacattcactcaggacaggcag
ataagattttctcaaggtcaacaacttgtgaccaaattagtgactgctcctgtagcttgt
ggggcagtcatggtacctagtactatgcttatgggccaggtggtgactgcatatcctact
tttgctacacaacagcaacagtcacagacattgtcagtaacgcagcagcagcagcagcag
agctcccaggagcagcagctcacttcagttcagcaaccatctcaggctcagctgacccag
ccaccgcaacaatttttacagacttctaggttgctccatgggaatccctcaactcaactc
attctctctgctgcatttcctctacaacagagcaccttccctcagtcacatcaccagcaa
catcagtctcagcaacagcagcaactcagccggcacaggactgacagcttgcccgaccct
tccaaggttcaaccacagtag

DBGET integrated database retrieval system