KEGG   Homo sapiens (human): 53947
Entry
53947             CDS       T01001                                 
Symbol
A4GALT, A14GALT, A4GALT1, Gb3S, P(k), P1, P1PK, PK
Name
(RefSeq) alpha 1,4-galactosyltransferase (P blood group)
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00601  Glycosphingolipid biosynthesis - lacto and neolacto series
hsa00603  Glycosphingolipid biosynthesis - globo and isoglobo series
hsa01100  Metabolic pathways
Module
hsa_M00068  Glycosphingolipid biosynthesis, globo-series, LacCer => Gb4Cer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    53947 (A4GALT)
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    53947 (A4GALT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    53947 (A4GALT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     53947 (A4GALT)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  P blood group
   53947 (A4GALT)
SSDB
Motif
Pfam: Gb3_synth Gly_transf_sug
Other DBs
NCBI-GeneID: 53947
NCBI-ProteinID: NP_001304967
OMIM: 607922
HGNC: 18149
Ensembl: ENSG00000128274
Vega: OTTHUMG00000150744
Pharos: Q9NPC4(Tbio)
UniProt: Q9NPC4 A0A0S2Z5J1
Position
22:complement(42692121..42721301)
AA seq 353 aa
MSKPPDLLLRLLRGAPRQRVCTLFIIGFKFTFFVSIMIYWHVVGEPKEKGQLYNLPAEIP
CPTLTPPTPPSHGPTPGNIFFLETSDRTNPNFLFMCSVESAARTHPESHVLVLMKGLPGG
NASLPRHLGISLLSCFPNVQMLPLDLRELFRDTPLADWYAAVQGRWEPYLLPVLSDASRI
ALMWKFGGIYLDTDFIVLKNLRNLTNVLGTQSRYVLNGAFLAFERRHEFMALCMRDFVDH
YNGWIWGHQGPQLLTRVFKKWCSIRSLAESRACRGVTTLPPEAFYPIPWQDWKKYFEDIN
PEELPRLLSATYAVHVWNKKSQGTRFEATSRALLAQLHARYCPTTHEAMKMYL
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgtccaagccccccgacctcctgctgcggctgctccggggcgccccaaggcagcgggtc
tgcaccctgttcatcatcggcttcaagttcacgtttttcgtctccatcatgatctactgg
cacgttgtgggagagcccaaggagaaagggcagctctataacctgccagcagagatcccc
tgccccaccttgacaccccccaccccaccctcccacggccccactccaggcaacatcttc
ttcctggagacttcagaccggaccaaccccaacttcctgttcatgtgctcggtggagtcg
gccgccagaactcaccccgaatcccacgtgctggtcctgatgaaagggcttccgggtggc
aacgcctctctgccccggcacctgggcatctcacttctgagctgcttcccgaatgtccag
atgctcccgctggacctgcgggagctgttccgggacacacccctggccgactggtacgcg
gccgtgcaggggcgctgggagccctacctgctgcccgtgctctccgacgcctccaggatc
gcactcatgtggaagttcggcggcatctacctggacacggacttcattgttctcaagaac
ctgcggaacctgaccaacgtgctgggcacccagtcccgctacgtcctcaacggcgcgttc
ctggccttcgagcgccggcacgagttcatggcgctgtgcatgcgggacttcgtggaccac
tacaacggctggatctggggtcaccagggcccgcagctgctcacgcgggtcttcaagaag
tggtgttccatccgcagcctggccgagagccgcgcctgccgcggcgtcaccaccctgccc
cctgaggccttctaccccatcccctggcaggactggaagaagtactttgaggacatcaac
cccgaggagctgccgcggctgctcagtgccacctatgctgtccacgtgtggaacaagaag
agccagggcacgcggttcgaggccacgtccagggcactgctggcccagctgcatgcccgc
tactgccccacgacgcacgaggccatgaaaatgtacttgtga

DBGET integrated database retrieval system