KEGG   Homo sapiens (human): 5431
Entry
5431              CDS       T01001                                 

Gene name
POLR2B, POL2RB, RPB2, hRPB140
Definition
(RefSeq) RNA polymerase II subunit B
  KO
K03010  DNA-directed RNA polymerase II subunit RPB2 [EC:2.7.7.6]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    5431 (POLR2B)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    5431 (POLR2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    5431 (POLR2B)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5431 (POLR2B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     5431 (POLR2B)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Core subunits
     5431 (POLR2B)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      5431 (POLR2B)
SSDB
Motif
Pfam: RNA_pol_Rpb2_6 RNA_pol_Rpb2_1 RNA_pol_Rpb2_2 RNA_pol_Rpb2_7 RNA_pol_Rpb2_4 RNA_pol_Rpb2_3 RNA_pol_Rpb2_5
Other DBs
NCBI-GeneID: 5431
NCBI-ProteinID: NP_000929
OMIM: 180661
HGNC: 9188
Ensembl: ENSG00000047315
Vega: OTTHUMG00000128771
Pharos: P30876(Tbio)
UniProt: P30876 B4DH29
Structure
PDB: 

Position
4q12
AA seq 1174 aa
MYDADEDMQYDEDDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVE
DAPPIDLQAEAQHASGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTY
SAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLD
PGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSML
ARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEM
VKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETK
KAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRIYAQ
KFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLS
HLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSP
ILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSE
VSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHIDQLKEREYNNYSWQDLVASG
VVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSP
RNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIV
AIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGM
RHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELESTNRRYTKRDCSTFLRTSE
TGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEG
ITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGY
HLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSR
DGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGIMAIANTRTHTYECRGC
RNKTQISLVRMPYACKLLFQELMSMSIAPRMMSV
NT seq 3525 nt   +upstreamnt  +downstreamnt
atgtacgacgcggatgaggatatgcaatatgatgaggatgatgatgaaatcaccccggat
ttgtggcaagaagcatgctggattgtaatcagttcctattttgacgagaaaggcttggtt
agacaacagctggattcttttgatgagtttattcagatgtctgttcaaagaattgtggaa
gacgctcctcctatagacctacaggctgaagctcagcatgctagtggagaagttgaagaa
ccgccacgatatttgctgaagtttgaacaaatttatctttccaagcctacccattgggaa
agagatggtgctccttcaccaatgatgcccaatgaagctagattaaggaatctcacgtat
tctgctccgctttatgttgatataacaaaaacagtcattaaagaaggtgaagaacaactt
cagactcagcatcagaaaacttttataggaaaaattccaattatgttgcggtcaacttac
tgccttttgaatggcttgacagatcgtgatctttgtgagttaaatgaatgccctttggat
cctggtggctatttcattattaatggatcagaaaaggttctgattgcccaagagaaaatg
gcaacaaacacagtttatgtgtttgccaaaaaggattctaaatatgcctacacaggagag
tgtagatcatgtcttgagaattcttcccgacccaccagtactatatgggttagcatgctg
gcaagaggaggacagggtgccaagaagagtgctattggtcagcgcattgtggcaactcta
ccatatatcaagcaagaagttcccatcattattgtgttcagagcattaggttttgtgtcc
gacagagatattttagaacatattatttatgattttgaagatccagagatgatggaaatg
gttaaaccttctctcgatgaagcttttgtcatccaagaacagaatgttgcactaaatttc
attggttcaagaggagcaaagcctggtgttactaaagagaaaagaattaaatatgcaaag
gaagttttacaaaaagaaatgctccctcatgttggtgtcagtgatttttgtgagaccaaa
aaagcctatttcttgggatacatggttcataggttacttctggcagctttgggtagaaga
gaactagatgacagagatcactatggaaacaagagattggatcttgctgggccgctgctt
gcattcttatttagaggtatgtttaagaatttgcttaaagaagtgcggatctatgcacag
aaatttattgatcgaggaaaggattttaacttggagttggcaattaaaacacggatcata
tctgatggcctaaaatactctttagctactggaaactggggtgatcaaaagaaagctcat
caagccagagctggagtatctcaggtgttaaaccgcctgacttttgcgtctactctttct
cacctgcgtcgtttaaattctcctattggtagagacggcaagctagcaaaaccaagacag
ttgcataatacgttgtggggaatggtgtgtcctgccgagaccccagagggccatgctgta
ggacttgtgaagaatttagccttgatggcgtatatttcagttggatctcaaccatctcca
attctggaatttttagaagaatggagtatggaaaatttagaagaaatttctcctgcagct
attgctgatgcaaccaagatttttgttaatggctgctgggttggaatacataaagatccc
gaacaacttatgaacaccctaaggaaattgagacgtcagatggacatcattgtgtctgaa
gtttctatgatcagagatattcgagagagggagattcggatctatacggatgcaggccgt
atttgtagaccacttctgattgtggaaaaacaaaagctacttttgaagaagaggcatatt
gaccaattgaaagagagagaatataacaactatagttggcaggatcttgtggccagtggg
gtagtggagtatattgataccctggaagaagaaacagtgatgcttgcaatgactccagat
gatttacaggagaaagaagtagcttattgttccacatatacacactgtgagattcatccc
tcaatgatccttggtgtctgtgcatctattattccctttcctgatcataaccagtcccct
agaaacacataccagtctgctatgggtaagcaggctatgggagtttacatcaccaacttc
catgttcgcatggacacattggcccatgttctctattatcctcaaaagccacttgtgact
acacggtctatggaatatctacgatttagagagctgccagcaggcatcaactcaattgtg
gccattgcatcatacactggatataatcaggaagactctgttatcatgaatcgttcagct
gtagaccgcggcttcttcaggtctgttttctatcgctcatacaaagaacaggagtctaaa
aaaggatttgatcaagaagaagtttttgagaagcctacacgtgaaacatgccagggcatg
aggcatgccatttacgacaagctggatgatgatggtttgatagctccaggggttcgtgta
tcaggagatgatgttattataggcaaaacagtcaccttgcctgaaaatgaagatgaattg
gagagcaccaatagacgctataccaagagagactgtagcacttttctcagaactagcgag
acgggcattgtggatcaggttatggtaactctcaatcaggaaggatataaattttgtaaa
ataagggtacgctctgttaggattccacagattggagacaaatttgctagtcgacatggt
caaaagggtacttgtggtattcagtatagacaagaggatatgcctttcacctgtgaaggt
atcacccctgatatcatcatcaatccccatgccatcccctctcgtatgactattggtcac
ttaattgaatgccttcaagggaaggtatcggctaacaagggtgaaattggtgatgccact
ccatttaatgatgctgttaacgtgcagaagatttctaatcttttatctgattatggctat
catctcagaggaaatgaggtcctgtacaatgggttcactggtcgaaaaatcacatcacaa
atatttattggccccacttattaccagcgtttgaagcatatggtggatgataagattcac
tctcgtgctaggggacctattcagatcctcaatagacagcccatggagggtagatctcgt
gatggtggcctgcgttttggagaaatggaacgagattgtcagattgcccatggagcagcc
cagtttttaagggaaagattgtttgaggcatcagatccatatcaggttcatgtttgcaat
ctttgtggaataatggcgattgccaacaccaggacccatacatatgaatgcaggggctgc
cgcaataaaacccagatttctttggtgcgaatgccttacgcatgcaaactattgtttcag
gaacttatgtctatgagtattgcaccgcgaatgatgagtgtttag

DBGET integrated database retrieval system