KEGG   Homo sapiens (human): 5441
Entry
5441              CDS       T01001                                 

Gene name
POLR2L, RBP10, RPABC5, RPB10, RPB10beta, RPB7.6, hRPB7.6
Definition
(RefSeq) RNA polymerase II, I and III subunit L
  KO
K03007  DNA-directed RNA polymerases I, II, and III subunit RPABC5
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa04623  Cytosolic DNA-sensing pathway
hsa05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    5441 (POLR2L)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    5441 (POLR2L)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    5441 (POLR2L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    5441 (POLR2L)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5441 (POLR2L)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     5441 (POLR2L)
  RNA polymerase III system
   RNA polymerase III
     5441 (POLR2L)
  RNA polymerase I system
   RNA polymerase I
     5441 (POLR2L)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      5441 (POLR2L)
SSDB
Motif
Pfam: RNA_pol_N
Other DBs
NCBI-GeneID: 5441
NCBI-ProteinID: NP_066951
OMIM: 601189
HGNC: 9199
Ensembl: ENSG00000177700
Vega: OTTHUMG00000133316
Pharos: P62875(Tbio)
UniProt: P62875
Structure
PDB: 

Position
11p15.5
AA seq 67 aa
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLL
NYAPLEK
NT seq 204 nt   +upstreamnt  +downstreamnt
atgatcatccctgtacgctgcttcacttgtggcaagatcgtcggcaacaagtgggaggct
tacctggggctgctgcaggccgagtacaccgagggggatgcgctggatgccctgggcctg
aagcgctactgctgccgccggatgctgctggcccacgtggacctgatcgagaagctgctc
aattatgcacccctggagaagtga

DBGET integrated database retrieval system