KEGG   Homo sapiens (human): 5498
Entry
5498              CDS       T01001                                 
Symbol
PPOX, PPO, V290M, VP
Name
(RefSeq) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00860  Porphyrin metabolism
hsa01100  Metabolic pathways
hsa01240  Biosynthesis of cofactors
Module
hsa_M00868  Heme biosynthesis, animals and fungi, glycine => heme
Network
nt06011  Heme biosynthesis
  Element
N00601  Heme biosynthesis
Disease
H00202  Hepatic porphyria
H01763  Porphyria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin metabolism
    5498 (PPOX)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     5498 (PPOX)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     5498 (PPOX)
SSDB
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Thi4 FAD_oxidored Pyr_redox_2 FAD_binding_2 NAD_binding_9
Other DBs
NCBI-GeneID: 5498
NCBI-ProteinID: NP_000300
OMIM: 600923
HGNC: 9280
Ensembl: ENSG00000143224
Pharos: P50336(Tchem)
UniProt: P50336
Structure
Position
1:161165728..161178013
AA seq 477 aa
MGRTVVVLGGGISGLAASYHLSRAPCPPKVVLVESSERLGGWIRSVRGPNGAIFELGPRG
IRPAGALGARTLLLVSELGLDSEVLPVRGDHPAAQNRFLYVGGALHALPTGLRGLLRPSP
PFSKPLFWAGLRELTKPRGKEPDETVHSFAQRRLGPEVASLAMDSLCRGVFAGNSRELSI
RSCFPSLFQAEQTHRSILLGLLLGAGRTPQPDSALIRQALAERWSQWSLRGGLEMLPQAL
ETHLTSRGVSVLRGQPVCGLSLQAEGRWKVSLRDSSLEADHVISAIPASVLSELLPAEAA
PLARALSAITAVSVAVVNLQYQGAHLPVQGFGHLVPSSEDPGVLGIVYDSVAFPEQDGSP
PGLRVTVMLGGSWLQTLEASGCVLSQELFQQRAQEAAATQLGLKEMPSHCLVHLHKNCIP
QYTLGHWQKLESARQFLTAHRLPLTLAGASYEGVAVNDCIESGRQAAVSVLGTEPNS
NT seq 1434 nt   +upstreamnt  +downstreamnt
atgggccggaccgtggtcgtgctgggcggaggcatcagcggcttggccgccagttaccac
ctgagccgggccccctgcccccctaaggtggtcctagtggagagcagtgagcgtctggga
ggctggattcgctccgttcgaggccctaatggtgctatctttgagcttggacctcgggga
attaggccagcgggagccctaggggcccggaccttgctcctggtttctgagcttggcttg
gattcagaagtgctgcctgtccggggagaccacccagctgcccagaacaggttcctctac
gtgggcggtgccctgcatgccctacccactggcctcagggggctactccgcccttcaccc
cccttctccaaacctctgttttgggctgggctgagggagctgaccaagccccggggcaaa
gagcctgatgagactgtgcacagttttgcccagcgccgccttggacctgaggtggcgtct
ctagccatggacagtctctgccgtggagtgtttgcaggcaacagccgtgagctcagcatc
aggtcctgctttcccagtctcttccaagctgagcaaacccatcgttccatattactgggc
ctgctgctgggggcagggcggaccccacagccagactcagcactcattcgccaggccttg
gctgagcgctggagccagtggtcacttcgtggaggtctagagatgttgcctcaggccctt
gaaacccacctgactagtaggggggtcagtgttctcagaggccagccggtctgtgggctc
agcctccaggcagaagggcgctggaaggtatctctaagggacagcagtctggaggctgac
cacgttattagtgccattccagcttcagtgctcagtgagctgctccctgctgaggctgcc
cctctggctcgtgccctgagtgccatcactgcagtgtctgtagctgtggtgaatctgcag
taccaaggagcccatctgcctgtccagggatttggacatttggtgccatcttcagaagat
ccaggagtcctgggaatcgtgtatgactcagttgctttccctgagcaggacgggagcccc
cctggcctcagagtgactgtgatgctgggaggttcctggttacagacactggaggctagt
ggctgtgtcttatctcaggagctgtttcaacagcgggcccaggaagcagctgctacacaa
ttaggactgaaggagatgccgagccactgcttggtccatctacacaagaactgcattccc
cagtatacactaggtcactggcaaaaactagagtcagctaggcaattcctgactgctcac
aggttgcccctgactctggctggagcctcctatgagggagttgctgttaatgactgtata
gagagtgggcgccaggcagcagtcagtgtcctgggcacagaacctaacagctga

DBGET integrated database retrieval system