KEGG   Homo sapiens (human): 55718
Entry
55718             CDS       T01001                                 

Gene name
POLR3E, C37, RPC5, SIN
Definition
(RefSeq) RNA polymerase III subunit E
  KO
K14721  DNA-directed RNA polymerase III subunit RPC5
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    55718 (POLR3E)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    55718 (POLR3E)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    55718 (POLR3E)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     55718 (POLR3E)
SSDB
Motif
Pfam: RPC5 RPC5_C
Other DBs
NCBI-GeneID: 55718
NCBI-ProteinID: NP_060589
OMIM: 617815
HGNC: 30347
Ensembl: ENSG00000058600
Vega: OTTHUMG00000094779
Pharos: Q9NVU0(Tbio)
UniProt: Q9NVU0
Position
16p12.2
AA seq 708 aa
MANEEDDPVVQEIDVYLAKSLAEKLYLFQYPVRPASMTYDDIPHLSAKIKPKQQKVELEM
AIDTLNPNYCRSKGEQIALNVDGACADETSTYSSKLMDKQTFCSSQTTSNTSRYAAALYR
QGELHLTPLHGILQLRPSFSYLDKADAKHREREAANEAGDSSQDEAEDDVKQITVRFSRP
ESEQARQRRVQSYEFLQKKHAEEPWVHLHYYGLRDSRSEHERQYLLCPGSSGVENTELVK
SPSEYLMMLMPPSQEEEKDKPVAPSNVLSMAQLRTLPLADQIKILMKNVKVMPFANLMSL
LGPSIDSVAVLRGIQKVAMLVQGNWVVKSDILYPKDSSSPHSGVPAEVLCRGRDFVMWKF
TQSRWVVRKEVATVTKLCAEDVKDFLEHMAVVRINKGWEFILPYDGEFIKKHPDVVQRQH
MLWTGIQAKLEKVYNLVKETMPKKPDAQSGPAGLVCGDQRIQVAKTKAQQNHALLERELQ
RRKEQLRVPAVPPGVRIKEEPVSEEGEEDEEQEAEEEPMDTSPSGLHSKLANGLPLGRAA
GTDSFNGHPPQGCASTPVARELKAFVEATFQRQFVLTLSELKRLFNLHLASLPPGHTLFS
GISDRMLQDTVLAAGCKQILVPFPPQTAASPDEQKVFALWESGDMSDQHRQVLLEIFSKN
YRVRRNMIQSRLTQECGEDLSKQEVDKVLKDCCVSYGGMWYLKGTVQS
NT seq 2127 nt   +upstreamnt  +downstreamnt
atggccaatgaagaggatgacccagttgtacaggagatcgatgtgtacttggccaagagt
ctggcggaaaagctgtatctatttcagtaccctgtgcgtccagcctcgatgacctacgat
gacattccgcacctctcagccaagatcaagcccaagcagcagaaggtagagcttgagatg
gccatcgacaccctgaaccccaactattgccgcagcaaaggggagcagattgcgctgaac
gtggacggggcctgcgccgacgagaccagcacgtattcctcgaagctgatggacaagcag
accttctgctcttcccagaccaccagtaacacatcccgttatgccgctgcactctacagg
caaggtgagctccacctgacacctttacatggcatcctgcagctgcggcccagcttctcc
tacctggataaggctgacgccaagcaccgggagagggaggcggccaacgaggcaggggac
tcttcacaggatgaggcggaagacgatgttaagcagatcacggtgcggttctcccggccg
gagtcagagcaggcccgccagcgccgtgtgcagtcctatgagttcctgcagaagaagcac
gcagaggagccctgggtccacctgcattactatggcctgagggacagtcgctctgagcat
gagcgtcagtacctgctgtgccccggctcaagcggggtggagaacacggagctcgtcaag
tcacccagtgagtacctgatgatgctgatgccacccagccaggaggaggagaaagacaag
cctgtggcccccagcaacgtcctgtcgatggcccagctgcgcacgctgcccctggccgat
cagatcaagatcctgatgaagaatgtgaaggtcatgccttttgccaacttgatgagcctc
ctgggcccctccatcgattccgtggctgttctgcggggcatccagaaggtggcgatgttg
gtccaagggaactgggtggtgaagagtgacatcctataccccaaggactcgtccagccct
cacagcggcgtgcctgctgaggtgctctgcaggggccgagacttcgttatgtggaagttc
acgcagagccgctgggtggttaggaaagaggtggcaaccgtgaccaaactctgcgccgag
gatgtgaaggacttcctggagcacatggccgtggtgaggatcaacaaaggctgggagttc
attctgccttatgatggggagttcatcaagaagcacccggatgtggtccagcggcagcac
atgctgtggacgggtatccaggccaaactggaaaaagtctataatcttgtaaaggaaacc
atgccaaagaagccggatgcacaatcagggcctgccgggctggtctgtggggaccagcgg
atccaagtagccaaaaccaaggcccagcagaaccacgcgttgctggagcgggagctgcag
cggcggaaggagcagctgcgggtgcctgcggtcccgcccggtgtgcggatcaaggaggag
cccgtgagcgaggagggcgaggaggacgaggagcaggaggcggaggaggagcccatggac
acttcccccagcggcctccacagcaagctggccaacgggctgcctctcgggcgggctgcg
ggcacagacagcttcaacgggcacccgccccagggctgcgccagcacccctgtggctcgg
gaactgaaggccttcgtggaggccacctttcagagacagtttgtgctcacgctgagcgaa
ctcaagcgcctcttcaatctgcacttggccagcctgccccccggccacacactcttcagc
ggcatctcggaccgcatgctacaggacacggtgctggccgccggttgcaagcagatactg
gtgccttttcccccccagactgctgcttccccggatgagcagaaggtgtttgccctctgg
gagtctggagacatgagtgatcagcatcgacaggttttgcttgaaattttttccaaaaat
taccgggtacgccgaaacatgatccagtctcggttgactcaagagtgtggagaagatctc
agtaaacaggaggtggataaagtactaaaggactgctgtgtaagctatggtggcatgtgg
taccttaaagggacagtacagtcttga

DBGET integrated database retrieval system