KEGG   Homo sapiens (human): 5688
Entry
5688              CDS       T01001                                 

Gene name
PSMA7, C6, HEL-S-276, HSPC, RC6-1, XAPC7
Definition
(RefSeq) proteasome 20S subunit alpha 7
  KO
K02731  20S proteasome subunit alpha 4 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
N01197  Scrapie conformation PrPSc to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5688 (PSMA7)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5688 (PSMA7)
   05012 Parkinson disease
    5688 (PSMA7)
   05014 Amyotrophic lateral sclerosis
    5688 (PSMA7)
   05016 Huntington disease
    5688 (PSMA7)
   05017 Spinocerebellar ataxia
    5688 (PSMA7)
   05020 Prion disease
    5688 (PSMA7)
   05022 Pathways of neurodegeneration - multiple diseases
    5688 (PSMA7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5688 (PSMA7)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5688 (PSMA7)
   03051 Proteasome [BR:hsa03051]
    5688 (PSMA7)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     5688 (PSMA7)
Peptidases and inhibitors [BR:hsa01002]
 Threonine peptidases
  Family T1: proteasome family
   5688 (PSMA7)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab associated proteins
    5688 (PSMA7)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    5688 (PSMA7)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N Peptidase_C65 DUF5069
Other DBs
NCBI-GeneID: 5688
NCBI-ProteinID: NP_002783
OMIM: 606607
HGNC: 9536
Ensembl: ENSG00000101182
Vega: OTTHUMG00000032895
Pharos: O14818(Tbio)
UniProt: O14818 A0A0K0K1K4
Structure
PDB: 

Position
20q13.33
AA seq 248 aa
MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVR
KICALDDNVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQ
SNGRRPFGISALIVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDEA
IETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQSLKILNPEEIEKYVAEIEKEKEENE
KKKQKKAS
NT seq 747 nt   +upstreamnt  +downstreamnt
atgagctacgaccgcgccatcaccgtcttctcgcccgacggccacctcttccaagtggag
tacgcgcaggaggccgtcaagaagggctcgaccgcggttggtgttcgaggaagagacatt
gttgttcttggtgtggagaagaagtcagtggccaaactgcaggatgaaagaacagtgcgg
aagatctgtgctttggatgacaacgtctgcatggcctttgcaggcctcaccgccgatgca
aggatagtcatcaacagggcccgggtggagtgccagagccaccggctgactgtggaggac
ccggtcactgtggagtacatcacccgctacatcgccagtctgaagcagcgttatacgcag
agcaatgggcgcaggccgtttggcatctctgccctcatcgtgggtttcgactttgatggc
actcctaggctctatcagactgacccctcgggcacataccatgcctggaaggccaatgcc
ataggtcggggtgccaagtcagtgcgcgagttcctggagaagaactatactgacgaagcc
attgaaacagatgatctgaccattaagctggtgatcaaggcactcctggaagtggttcag
tcaggtggcaaaaacattgaacttgctgtcatgaggcgagatcaatccctcaagatttta
aatcctgaagaaattgagaagtatgttgctgaaattgaaaaagaaaaagaagaaaacgaa
aagaagaaacaaaagaaagcatcatga

DBGET integrated database retrieval system