KEGG   Homo sapiens (human): 6095
Entry
6095              CDS       T01001                                 

Gene name
RORA, IDDECA, NR1F1, ROR1, ROR2, ROR3, RZR-ALPHA, RZRA
Definition
(RefSeq) RAR related orphan receptor A
  KO
K08532  RAR-related orphan receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04659  Th17 cell differentiation
hsa04710  Circadian rhythm
hsa05017  Spinocerebellar ataxia
hsa05321  Inflammatory bowel disease
Network
nt06440  Transcription
nt06462  Spinocerebellar ataxia
  Element
N00965  RORA-mediated transcription
N00966  Mutation-caused aberrant ATXN1 to RORA-mediated transcription
Disease
H02463  Syndromic intellectual developmental disorder
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    6095 (RORA)
  09159 Environmental adaptation
   04710 Circadian rhythm
    6095 (RORA)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    6095 (RORA)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    6095 (RORA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    6095 (RORA)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    6095 (RORA)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    6095 (RORA)
Nuclear receptors [BR:hsa03310]
 1. Thyroid hormone like
  1F. RAR-related orphan receptor
   6095 (RORA)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 6095
NCBI-ProteinID: NP_599023
OMIM: 600825
HGNC: 10258
Ensembl: ENSG00000069667
Vega: OTTHUMG00000132769
Pharos: P35398(Tchem)
UniProt: P35398
Structure
PDB: 
1N83 4S15 1S0X

Position
15q22.2
AA seq 523 aa
MESAPAAPDPAASEPGSSGADAAAGSRETPLNQESARKSEPPAPVRRQSYSSTSRGISVT
KKTHTSQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRT
SRNRCQHCRLQKCLAVGMSRDAVKFGRMSKKQRDSLYAEVQKHRMQQQQRDHQQQPGEAE
PLTPTYNISANGLTELHDDLSNYIDGHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIK
PEPICDYTPASGFFPYCSFTNGETSPTVSMAELEHLAQNISKSHLETCQYLREELQQITW
QTFLQEEIENYQNKQREVMWQLCAIKITEAIQYVVEFAKRIDGFMELCQNDQIVLLKAGS
LEVVFIRMCRAFDSQNNTVYFDGKYASPDVFKSLGCEDFISFVFEFGKSLCSMHLTEDEI
ALFSAFVLMSADRSWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRAL
CGRHTEKLMAFKAIYPDIVRLHFPPLYKELFTSEFEPAMQIDG
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggagtcagctccggcagcccccgaccccgccgccagcgagccaggcagcagcggcgcg
gacgcggccgccggctccagggagaccccgctgaaccaggaatccgcccgcaagagcgag
ccgcctgccccggtgcgcagacagagctattccagcaccagcagaggtatctcagtaacg
aagaagacacatacatctcaaattgaaattattccatgcaagatctgtggagacaaatca
tcaggaatccattatggtgtcattacatgtgaaggctgcaagggctttttcaggagaagt
cagcaaagcaatgccacctactcctgtcctcgtcagaagaactgtttgattgatcgaacc
agtagaaaccgctgccaacactgtcgattacagaaatgccttgccgtagggatgtctcga
gatgctgtaaaatttggccgaatgtcaaaaaagcagagagacagcttgtatgcagaagta
cagaaacaccggatgcagcagcagcagcgcgaccaccagcagcagcctggagaggctgag
ccgctgacgcccacctacaacatctcggccaacgggctgacggaacttcacgacgacctc
agtaactacattgacgggcacacccctgaggggagtaaggcagactccgccgtcagcagc
ttctacctggacatacagccttccccagaccagtcaggtcttgatatcaatggaatcaaa
ccagaaccaatatgtgactacacaccagcatcaggcttctttccctactgttcgttcacc
aacggcgagacttccccaactgtgtccatggcagaattagaacaccttgcacagaatata
tctaaatcgcatctggaaacctgccaatacttgagagaagagctccagcagataacgtgg
cagacctttttacaggaagaaattgagaactatcaaaacaagcagcgggaggtgatgtgg
caattgtgtgccatcaaaattacagaagctatacagtatgtggtggagtttgccaaacgc
attgatggatttatggaactgtgtcaaaatgatcaaattgtgcttctaaaagcaggttct
ctagaggtggtgtttatcagaatgtgccgtgcctttgactctcagaacaacaccgtgtac
tttgatgggaagtatgccagccccgacgtcttcaaatccttaggttgtgaagactttatt
agctttgtgtttgaatttggaaagagtttatgttctatgcacctgactgaagatgaaatt
gcattattttctgcatttgtactgatgtcagcagatcgctcatggctgcaagaaaaggta
aaaattgaaaaactgcaacagaaaattcagctagctcttcaacacgtcctacagaagaat
caccgagaagatggaatactaacaaagttaatatgcaaggtgtctaccttaagagcctta
tgtggacgacatacagaaaagctaatggcatttaaagcaatatacccagacattgtgcga
cttcattttcctccattatacaaggagttgttcacttcagaatttgagccagcaatgcaa
attgatgggtaa

KEGG   Homo sapiens (human): 10524
Entry
10524             CDS       T01001                                 

Gene name
KAT5, ESA1, HTATIP, HTATIP1, NEDFASB, PLIP, TIP, TIP60, ZC2HC5, cPLA2
Definition
(RefSeq) lysine acetyltransferase 5
  KO
K11304  histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05017  Spinocerebellar ataxia
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06440  Transcription
nt06462  Spinocerebellar ataxia
  Element
N00489  HTLV-1 p30II to c-myc-mediated transcription
N00965  RORA-mediated transcription
N00966  Mutation-caused aberrant ATXN1 to RORA-mediated transcription
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    10524 (KAT5)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    10524 (KAT5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    10524 (KAT5)
   03036 Chromosome and associated proteins [BR:hsa03036]
    10524 (KAT5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     10524 (KAT5)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2HisCys zinc factors
    10524 (KAT5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    10524 (KAT5)
   HAT complexes
    TIP60 complex
     10524 (KAT5)
    NuA4 complex
     10524 (KAT5)
SSDB
Motif
Pfam: MOZ_SAS zf-MYST Tudor-knot Acetyltransf_7 Acetyltransf_1
Other DBs
NCBI-GeneID: 10524
NCBI-ProteinID: NP_006379
OMIM: 601409
HGNC: 5275
Ensembl: ENSG00000172977
Vega: OTTHUMG00000166617
Pharos: Q92993(Tbio)
UniProt: Q92993 A0A024R597
Structure
PDB: 
2OU2 4QQG 2EKO

Position
11q13.1
AA seq 513 aa
MAEVGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEWVTH
ERLDLKKIQFPKKEAKTPTKNGLPGSRPGSPEREVPASAQASGKTLPIPVQITLRFNLPK
EREAIPGGEPDQPLSSSSCLQPNHRSTKRKVEVVSPATPVPSETAPASVFPQNGAARRAV
AAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRH
RLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTIS
FFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKE
STEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQ
TILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDI
VDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW
NT seq 1542 nt   +upstreamnt  +downstreamnt
atggcggaggtgggggagataatcgagggctgccgcctacccgtgctgcggcggaaccag
gacaacgaagatgagtggcccctggccgagatcctgagcgtgaaggacatcagtggccgg
aagcttttctacgtccattacattgacttcaacaaacgtctggatgaatgggtgacgcat
gagcggctggacctaaagaagatccagttccccaagaaagaggccaagacccccactaag
aacggacttcctgggtcccgtcctggctctccagagagagaggtgccggcctcggcgcag
gccagcgggaagaccttgccaatcccggtccagatcacactccgcttcaacctgcccaag
gagcgggaggccattcccggtggcgagcctgaccagccgctctcctccagctcctgcctg
cagcccaaccaccgctcaacgaaacggaaggtggaggtggtttcaccagcaactccagtg
cccagcgagacagccccggcctcggtttttccccagaatggagccgcccgtagggcagtg
gcagcccagccaggacggaagcgaaaatcgaattgtttgggcactgatgaggactcccag
gacagctctgatggaataccgtcagcaccacgcatgactggcagcctggtgtctgatcga
agccacgacgacatcgtcacccggatgaagaacattgagtgcattgagctgggccggcac
cgcctcaagccgtggtacttctccccgtacccacaggaactcaccacattgcctgtcctc
tacctgtgcgagttctgcctcaagtacggccgtagtctcaagtgtcttcagcgtcatttg
accaagtgtgacctacgacatcctccaggcaatgagatttaccgcaagggcaccatctcc
ttctttgagattgatggacgtaagaacaagagttattcccagaacctgtgtcttttggcc
aagtgtttccttgaccataagacactgtactatgacacagaccctttcctcttctacgtc
atgacagagtatgactgtaagggcttccacatcgtgggctacttctccaaggagaaagaa
tcaacggaagactacaatgtggcctgcatcctaaccctgcctccctaccagcgccggggc
tacggcaagctgctgatcgagttcagctatgaactctccaaagtggaagggaaaacaggg
acccctgagaagcccctctcagaccttggcctcctatcctatcgaagctactggtcccag
accatcctggagatcctgatggggctgaagtcggagagcggggagaggccacagatcacc
atcaatgagattagtgaaatcaccagcatcaagaaggaggatgtcatctccactctgcag
tacctcaatctcatcaactactacaagggccagtacatcctcacactgtcagaggacatc
gtggatggccatgagcgggccatgctcaagcggctcctgcggatcgactccaagtgtctg
cacttcactcccaaggactggagcaagagggggaagtggtga

DBGET integrated database retrieval system