KEGG   Homo sapiens (human): 63916
Entry
63916             CDS       T01001                                 

Symbol
ELMO2, CED-12, CED12, Ced-12A, ELMO-2, VMPI
Name
(RefSeq) engulfment and cell motility 2
  KO
K18985  engulfment and cell motility protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa05100  Bacterial invasion of epithelial cells
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05135  Yersinia infection
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N00951  ITGA/B-RHOG-RAC signaling pathway
N00952  Shigella IpgB1 to ITGA/B-RHOG-RAC signaling pathway
N01132  Salmonella SopE/E2 to RhoG signaling pathway
N01133  Salmonella SopB to RhoG signaling pathway
Disease
H02088  Primary intraosseous vascular malformation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    63916 (ELMO2)
   05131 Shigellosis
    63916 (ELMO2)
   05135 Yersinia infection
    63916 (ELMO2)
   05100 Bacterial invasion of epithelial cells
    63916 (ELMO2)
SSDB
Motif
Pfam: ELMO_ARM PH_12 ELMO_CED12
Other DBs
NCBI-GeneID: 63916
NCBI-ProteinID: NP_573403
OMIM: 606421
HGNC: 17233
Ensembl: ENSG00000062598
Vega: OTTHUMG00000033070
Pharos: Q96JJ3(Tbio)
UniProt: Q96JJ3
Structure
Position
20:complement(46366050..46407051)
AA seq 720 aa
MPPPSDIVKVAIEWPGANAQLLEIDQKRPLASIIKEVCDGWSLPNPEYYTLRYADGPQLY
ITEQTRSDIKNGTILQLAISPSRAARQLMERTQSSNMETRLDAMKELAKLSADVTFATEF
INMDGIIVLTRLVESGTKLLSHYSEMLAFTLTAFLELMDHGIVSWDMVSITFIKQIAGYV
SQPMVDVSILQRSLAILESMVLNSQSLYQKIAEEITVGQLISHLQVSNQEIQTYAIALIN
ALFLKAPEDKRQDMANAFAQKHLRSIILNHVIRGNRPIKTEMAHQLYVLQVLTFNLLEER
MMTKMDPNDQAQRDIIFELRRIAFDAESDPSNAPGSGTEKRKAMYTKDYKMLGFTNHINP
AMDFTQTPPGMLALDNMLYLAKVHQDTYIRIVLENSSREDKHECPFGRSAIELTKMLCEI
LQVGELPNEGRNDYHPMFFTHDRAFEELFGICIQLLNKTWKEMRATAEDFNKVMQVVREQ
ITRALPSKPNSLDQFKSKLRSLSYSEILRLRQSERMSQDDFQSPPIVELREKIQPEILEL
IKQQRLNRLCEGSSFRKIGNRRRQERFWYCRLALNHKVLHYGDLDDNPQGEVTFESLQEK
IPVADIKAIVTGKDCPHMKEKSALKQNKEVLELAFSILYDPDETLNFIAPNKYEYCIWID
GLSALLGKDMSSELTKSDLDTLLSMEMKLRLLDLENIQIPEAPPPIPKEPSSYDFVYHYG
NT seq 2163 nt   +upstreamnt  +downstreamnt
atgccaccaccgtcagacattgtcaaagtggccattgagtggccaggtgctaacgcccag
ctccttgaaatcgaccagaaacggcccctggcatccattatcaaggaagtttgtgatggg
tggtcgttgccaaacccagagtattataccctccgttatgcagatggtcctcagctgtac
atcaccgaacagactcgcagtgacattaagaatgggacaatcttacaactggctatctcc
ccgtcccgggctgcacgccagctgatggagaggacccagtcatccaacatggagacccgg
ctggatgccatgaaggagctggccaagctctctgccgacgtgactttcgctactgagttc
atcaacatggatggcatcattgtgctgacaaggctcgtggaaagtggaaccaagctcttg
tcccactacagtgagatgctggcattcaccctgactgccttcctagagctcatggaccat
ggcattgtctcctgggacatggtttcaatcacctttattaagcagattgcagggtatgtg
agccagcccatggtggacgtgtcaatccttcagaggtccctggccatcctggagagcatg
gtcttgaacagccagagtctgtaccagaagatagccgaggaaatcaccgtgggacagctc
atctcacacctccaggtctccaaccaggagattcagacctacgccattgcactgattaat
gcactttttctgaaggctcctgaggacaaacgacaggatatggcaaatgcatttgcacag
aagcatctccggtctataatcctgaatcatgtgatccgagggaaccgccccatcaaaact
gagatggcccatcagctatatgtccttcaagtcctaacctttaaccttctggaagaaagg
atgatgaccaagatggaccccaatgaccaggctcaaagggacatcatatttgaactgagg
aggattgcatttgacgcagagtctgatcctagcaatgcccctgggagtgggaccgaaaaa
cgcaaagccatgtacacaaaggactacaaaatgctgggatttaccaaccacatcaatcca
gccatggactttacccagactcctcctggaatgctggccttggacaacatgctgtacttg
gctaaagtccaccaggacacctacatccggattgtcttggagaacagtagccgggaagac
aaacatgaatgcccctttggccgcagtgccattgagctcaccaaaatgctctgtgaaatc
ctgcaggttggggaactaccaaatgaaggacgcaatgactaccacccgatgttctttacc
catgaccgagcctttgaagagctctttggaatctgcatccagctgttgaacaagacctgg
aaggagatgagggcaacagcagaggacttcaacaaggttatgcaagtcgtccgagagcaa
atcactcgagctttgccctccaaacccaactctttggatcagttcaagagcaaattgcgt
agcctgagttactctgagattctacgactgcgccagtctgagaggatgagtcaggatgac
ttccagtccccgccaattgtggagctgagggagaagatccagcccgagatccttgagctg
atcaagcagcagcgcctgaaccggctctgtgagggcagcagcttccgaaagattgggaac
cgccgaaggcaagaacggttctggtactgccggttggcactgaaccacaaggtccttcac
tatggtgacttggatgacaacccacaaggggaggtgacatttgaatccctgcaggagaaa
attcctgttgcagacattaaggccattgtcactgggaaagattgtccccacatgaaagag
aaaagtgctctgaaacagaacaaggaggtgttggaattggccttctccatcctgtatgac
cctgatgagaccttaaacttcatcgcacctaataaatatgagtactgcatctggattgat
ggcctcagtgcccttctggggaaggacatgtccagtgagctgaccaagagtgacctggac
accctgctgagcatggagatgaagctgcggctcctggacctggagaacatccagattccc
gaagccccaccccccatccccaaggagcccagcagctatgactttgtctatcactatggc
tga

DBGET integrated database retrieval system