KEGG   Homo sapiens (human): 64425
Entry
64425             CDS       T01001                                 

Gene name
POLR1E, A49, PAF53, PRAF1, RPA49
Definition
(RefSeq) RNA polymerase I subunit E
  KO
K03005  DNA-directed RNA polymerase I subunit RPA49
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    64425 (POLR1E)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    64425 (POLR1E)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase I system
   RNA polymerase I
    Pol I specific subunits
     64425 (POLR1E)
SSDB
Motif
Pfam: RNA_pol_I_A49 DUF4239 U62_UL91
Other DBs
NCBI-GeneID: 64425
NCBI-ProteinID: NP_071935
HGNC: 17631
Ensembl: ENSG00000137054
Vega: OTTHUMG00000019920
Pharos: Q9GZS1(Tbio)
UniProt: Q9GZS1
Position
9p13.2
AA seq 419 aa
MAAEVLPSARWQYCGAPDGSQRAVLVQFSNGKLQSPGNMRFTLYENKDSTNPRKRNQRIL
AAETDRLSYVGNNFGTGALKCNTLCRHFVGILNKTSGQMEVYDAELFNMQPLFSDVSVES
ELALESQTKTYREKMDSCIEAFGTTKQKRALNTRRMNRVGNESLNRAVAKAAETIIDTKG
VTALVSDAIHNDLQDDSLYLPPCYDDAAKPEDVYKFEDLLSPAEYEALQSPSEAFRNVTS
EEILKMIEENSHCTFVIEALKSLPSDVESRDRQARCIWFLDTLIKFRAHRVVKRKSALGP
GVPHIINTKLLKHFTCLTYNNGRLRNLISDSMKAKITAYVIILALHIHDFQIDLTVLQRD
LKLSEKRMMEIAKAMRLKISKRRVSVAAGSEEDHKLGTLSLPLPPAQTSDRLAKRRKIT
NT seq 1260 nt   +upstreamnt  +downstreamnt
atggcggcggaggtgttgccgagtgcgaggtggcagtattgtggggcgcccgacgggagc
cagagagctgtactggtccagttctccaacgggaagctacagagtccaggcaacatgcgc
tttaccttgtatgagaacaaagattccaccaaccccaggaagaggaatcaacggatcctg
gcagctgaaacagataggctctcctatgtgggaaacaattttgggactggagccctcaaa
tgcaacactttgtgcaggcactttgtgggaattttgaacaagacctctggccaaatggaa
gtatatgatgctgaattgttcaacatgcagccactattttcagatgtatcagttgagagt
gaactggcgctagagagtcagaccaaaacttacagagaaaagatggattcttgtattgaa
gcctttggtaccaccaaacagaagcgagctctgaacaccaggagaatgaacagagttggc
aatgaatctttgaatcgtgcagtggctaaagctgcagagactatcattgatacgaagggt
gtgactgctctggtcagcgatgctatccacaatgacttgcaagatgactccctctacctt
cctccctgctatgatgatgcagccaagcctgaagacgtgtataaatttgaagatcttctt
tcccctgcggagtatgaagctcttcagagcccatctgaagctttcaggaacgtcacgtca
gaagaaatactgaagatgattgaggagaacagccattgcacctttgtcatagaagcgttg
aagtctttgccatcagatgtggagagccgagaccgccaggcccgatgcatatggtttctg
gataccctcatcaaatttcgagctcatagggtagttaagcggaaaagtgctctgggacct
ggagttccccacatcatcaacaccaaactgctgaagcactttacttgcttgacctacaac
aatggcagattacggaacttaatttcggattctatgaaggcgaagattactgcatatgtg
atcatacttgccttgcacatacatgacttccaaattgacctgacagtgttacagagggac
ttgaagctcagtgagaaaaggatgatggagatagccaaagccatgaggctgaagatctcc
aaaagaagggtgtctgtggccgccggcagtgaagaagatcacaagctgggcaccctgtcc
ctcccgctgcctccagcccagacctcagaccgcctggcaaagcggaggaagattacctag

DBGET integrated database retrieval system