KEGG   Homo sapiens (human): 661
Entry
661               CDS       T01001                                 

Gene name
POLR3D, BN51T, C53, RPC4, RPC53, TSBN51
Definition
(RefSeq) RNA polymerase III subunit D
  KO
K03026  DNA-directed RNA polymerase III subunit RPC4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    661 (POLR3D)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    661 (POLR3D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    661 (POLR3D)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     661 (POLR3D)
SSDB
Motif
Pfam: RNA_pol_Rpc4
Other DBs
NCBI-GeneID: 661
NCBI-ProteinID: NP_001713
OMIM: 187280
HGNC: 1080
Ensembl: ENSG00000168495
Vega: OTTHUMG00000163778
Pharos: P05423(Tbio)
UniProt: P05423
Position
8p21.3
AA seq 398 aa
MSEGNAAGEPSTPGGPRPLLTGARGLIGRRPAPPLTPGRLPSIRSRDLTLGGVKKKTFTP
NIISRKIKEEPKEEVTVKKEKRERDRDRQREGHGRGRGRPEVIQSHSIFEQGPAEMMKKK
GNWDKTVDVSDMGPSHIINIKKEKRETDEETKQILRMLEKDDFLDDPGLRNDTRNMPVQL
PLAHSGWLFKEENDEPDVKPWLAGPKEEDMEVDIPAVKVKEEPRDEEEEAKMKAPPKAAR
KTPGLPKDVSVAELLRELSLTKEEELLFLQLPDTLPGQPPTQDIKPIKTEVQGEDGQVVL
IKQEKDREAKLAENACTLADLTEGQVGKLLIRKSGRVQLLLGKVTLDVTMGTACSFLQEL
VSVGLGDSRTGEMTVLGHVKHKLVCSPDFESLLDHKHR
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgtcggaaggaaacgccgccggcgagcccagcacgccgggagggccccgacctctcctg
actggggcccgggggctcatcgggcggcggccggcgcctcccctcacccccggccgcctt
ccctccatccgttccagggacctcaccctcgggggagtcaagaagaaaaccttcacccca
aatatcatcagtcggaagatcaaggaagagcccaaggaagaagtaactgtcaagaaggag
aagcgtgaaagggacagagaccgacaacgagaggggcatggacgagggcgaggccgtcca
gaagtgatccagtctcactccatctttgagcagggcccagctgaaatgatgaagaaaaaa
gggaactgggataagacagtggatgtgtcagacatgggaccttctcatatcatcaacatc
aaaaaagagaagagagagacagacgaagaaactaaacagatcttgcgtatgctggagaag
gacgatttcctcgatgaccccggcctgaggaacgacactcgaaatatgcctgtgcagctg
ccgctggctcactcaggatggctttttaaggaagaaaatgacgaaccagatgttaaacct
tggctggctggccccaaggaagaggacatggaggtggacatacctgctgtgaaagtgaaa
gaggagccacgagatgaggaggaagaggccaagatgaaggctcctcccaaagcagccagg
aagactccaggcctcccgaaggatgtatctgtggcagagctgctgagggagctgagcctc
accaaggaagaggaactgctgtttctgcagctgccagacaccctccctggccagccaccc
acccaggacatcaagcctatcaagacagaggtgcagggcgaggacggacaggtggtgctc
atcaagcaggagaaagaccgagaagccaaattggcagagaatgcttgtaccctggctgac
ctgacagagggtcaggttggcaagctactcatccgcaagtctggaagggtgcaactcctc
ttgggcaaggtgactctggacgtgaccatgggaactgcctgctccttcctgcaggagctg
gtgtccgtgggccttggagacagtaggacaggggagatgacagtcctgggacacgtgaag
cacaaacttgtatgttcccctgattttgaatccctcttggatcacaaacaccggtaa

DBGET integrated database retrieval system