Entry |
|
Symbol |
TNF, DIF, TNF-alpha, TNFA, TNFSF2, TNLG1F
|
Name |
(RefSeq) tumor necrosis factor
|
KO |
K03156 | tumor necrosis factor superfamily, member 2 |
|
Organism |
|
Pathway |
hsa04060 | Cytokine-cytokine receptor interaction |
hsa04061 | Viral protein interaction with cytokine and cytokine receptor |
hsa04612 | Antigen processing and presentation |
hsa04620 | Toll-like receptor signaling pathway |
hsa04621 | NOD-like receptor signaling pathway |
hsa04622 | RIG-I-like receptor signaling pathway |
hsa04625 | C-type lectin receptor signaling pathway |
hsa04650 | Natural killer cell mediated cytotoxicity |
hsa04660 | T cell receptor signaling pathway |
hsa04664 | Fc epsilon RI signaling pathway |
hsa04920 | Adipocytokine signaling pathway |
hsa04932 | Non-alcoholic fatty liver disease |
hsa04933 | AGE-RAGE signaling pathway in diabetic complications |
hsa05022 | Pathways of neurodegeneration - multiple diseases |
hsa05130 | Pathogenic Escherichia coli infection |
hsa05163 | Human cytomegalovirus infection |
hsa05166 | Human T-cell leukemia virus 1 infection |
hsa05168 | Herpes simplex virus 1 infection |
hsa05170 | Human immunodeficiency virus 1 infection |
hsa05418 | Fluid shear stress and atherosclerosis |
|
Network |
nt06121 TLR signaling (viruses and bacteria) nt06123 TNF signaling (viruses and bacteria) nt06131 Apoptosis (viruses and bacteria) nt06150 Cytokine-cytokine receptor interaction (viruses) nt06160 Human T-cell leukemia virus 1 (HTLV-1) nt06161 Human immunodeficiency virus type 1 (HIV-1) nt06162 Hepatitis B virus (HBV) nt06163 Hepatitis C virus (HCV) nt06164 Kaposi sarcoma-associated herpesvirus (KSHV) nt06165 Epstein-Barr virus (EBV) nt06166 Human papillomavirus (HPV) nt06167 Human cytomegalovirus (HCMV) nt06168 Herpes simplex virus 1 (HSV-1) nt06169 Measles virus (MV) nt06171 Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) nt06223 TNF signaling nt06231 Apoptosis nt06263 Hepatocellular carcinoma nt06414 Apoptosis nt06416 TNF signaling nt06417 AGE-RAGE signaling nt06460 Alzheimer disease nt06461 Huntington disease |
Element |
N00145 | Extrinsic apoptotic pathway |
N00151 | TNF-NFKB signaling pathway |
N00374 | TNF-IRF1 signaling pathway |
N00435 | TLR2/4-NFKB signaling pathway |
N00436 | HIV Tat to TLR2/4-NFKB signaling pathway |
N00444 | TNF-p38 signaling pathway |
N00446 | TNF-JNK signaling pathway |
N00994 | AGE-RAGE signaling pathway |
N00996 | Mutation-caused aberrant Abeta to AGE-RAGE signaling pathway |
N01276 | VAV CrmB to TNFR signaling |
N01307 | SARS-CoV-2 S to AngII-AT1R-NOX2 signaling pathway |
|
Disease |
H00080 | Systemic lupus erythematosus |
H00084 | Graft-versus-host disease |
|
Drug target |
Certolizumab pegol: | D03441<JP/US> |
|
Brite |
KEGG Orthology (KO) [BR:hsa00001]
09130 Environmental Information Processing
09132 Signal transduction
04010 MAPK signaling pathway
7124 (TNF)
04350 TGF-beta signaling pathway
7124 (TNF)
04064 NF-kappa B signaling pathway
7124 (TNF)
04668 TNF signaling pathway
7124 (TNF)
04071 Sphingolipid signaling pathway
7124 (TNF)
04150 mTOR signaling pathway
7124 (TNF)
09133 Signaling molecules and interaction
04060 Cytokine-cytokine receptor interaction
7124 (TNF)
04061 Viral protein interaction with cytokine and cytokine receptor
7124 (TNF)
09140 Cellular Processes
09143 Cell growth and death
04210 Apoptosis
7124 (TNF)
04217 Necroptosis
7124 (TNF)
09150 Organismal Systems
09151 Immune system
04640 Hematopoietic cell lineage
7124 (TNF)
04620 Toll-like receptor signaling pathway
7124 (TNF)
04621 NOD-like receptor signaling pathway
7124 (TNF)
04622 RIG-I-like receptor signaling pathway
7124 (TNF)
04625 C-type lectin receptor signaling pathway
7124 (TNF)
04650 Natural killer cell mediated cytotoxicity
7124 (TNF)
04612 Antigen processing and presentation
7124 (TNF)
04660 T cell receptor signaling pathway
7124 (TNF)
04657 IL-17 signaling pathway
7124 (TNF)
04664 Fc epsilon RI signaling pathway
7124 (TNF)
09152 Endocrine system
04920 Adipocytokine signaling pathway
7124 (TNF)
09158 Development and regeneration
04380 Osteoclast differentiation
7124 (TNF)
09160 Human Diseases
09161 Cancer: overview
05205 Proteoglycans in cancer
7124 (TNF)
09172 Infectious disease: viral
05166 Human T-cell leukemia virus 1 infection
7124 (TNF)
05170 Human immunodeficiency virus 1 infection
7124 (TNF)
05161 Hepatitis B
7124 (TNF)
05160 Hepatitis C
7124 (TNF)
05171 Coronavirus disease - COVID-19
7124 (TNF)
05164 Influenza A
7124 (TNF)
05168 Herpes simplex virus 1 infection
7124 (TNF)
05163 Human cytomegalovirus infection
7124 (TNF)
05169 Epstein-Barr virus infection
7124 (TNF)
05165 Human papillomavirus infection
7124 (TNF)
09171 Infectious disease: bacterial
05130 Pathogenic Escherichia coli infection
7124 (TNF)
05132 Salmonella infection
7124 (TNF)
05131 Shigellosis
7124 (TNF)
05135 Yersinia infection
7124 (TNF)
05133 Pertussis
7124 (TNF)
05134 Legionellosis
7124 (TNF)
05152 Tuberculosis
7124 (TNF)
09174 Infectious disease: parasitic
05146 Amoebiasis
7124 (TNF)
05144 Malaria
7124 (TNF)
05145 Toxoplasmosis
7124 (TNF)
05140 Leishmaniasis
7124 (TNF)
05142 Chagas disease
7124 (TNF)
05143 African trypanosomiasis
7124 (TNF)
09163 Immune disease
05310 Asthma
7124 (TNF)
05322 Systemic lupus erythematosus
7124 (TNF)
05323 Rheumatoid arthritis
7124 (TNF)
05321 Inflammatory bowel disease
7124 (TNF)
05330 Allograft rejection
7124 (TNF)
05332 Graft-versus-host disease
7124 (TNF)
09164 Neurodegenerative disease
05010 Alzheimer disease
7124 (TNF)
05014 Amyotrophic lateral sclerosis
7124 (TNF)
05020 Prion disease
7124 (TNF)
05022 Pathways of neurodegeneration - multiple diseases
7124 (TNF)
09166 Cardiovascular disease
05417 Lipid and atherosclerosis
7124 (TNF)
05418 Fluid shear stress and atherosclerosis
7124 (TNF)
05410 Hypertrophic cardiomyopathy
7124 (TNF)
05414 Dilated cardiomyopathy
7124 (TNF)
09167 Endocrine and metabolic disease
04930 Type II diabetes mellitus
7124 (TNF)
04940 Type I diabetes mellitus
7124 (TNF)
04936 Alcoholic liver disease
7124 (TNF)
04932 Non-alcoholic fatty liver disease
7124 (TNF)
04931 Insulin resistance
7124 (TNF)
04933 AGE-RAGE signaling pathway in diabetic complications
7124 (TNF)
09176 Drug resistance: antineoplastic
01523 Antifolate resistance
7124 (TNF)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04052 Cytokines and growth factors [BR:hsa04052]
7124 (TNF)
00536 Glycosaminoglycan binding proteins [BR:hsa00536]
7124 (TNF)
Cytokines and growth factors [BR:hsa04052]
Cytokines
Tumor necrosis fators
7124 (TNF)
Glycosaminoglycan binding proteins [BR:hsa00536]
Heparan sulfate / Heparin
Cytokines
7124 (TNF)
|
SSDB |
|
Motif |
|
Other DBs |
|
Structure |
|
Position |
6:31575565..31578336
|
AA seq |
233 aa
MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR
EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR
DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE
TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL |
NT seq |
702 nt +upstreamnt +downstreamnt
atgagcactgaaagcatgatccgggacgtggagctggccgaggaggcgctccccaagaag
acaggggggccccagggctccaggcggtgcttgttcctcagcctcttctccttcctgatc
gtggcaggcgccaccacgctcttctgcctgctgcactttggagtgatcggcccccagagg
gaagagttccccagggacctctctctaatcagccctctggcccaggcagtcagatcatct
tctcgaaccccgagtgacaagcctgtagcccatgttgtagcaaaccctcaagctgagggg
cagctccagtggctgaaccgccgggccaatgccctcctggccaatggcgtggagctgaga
gataaccagctggtggtgccatcagagggcctgtacctcatctactcccaggtcctcttc
aagggccaaggctgcccctccacccatgtgctcctcacccacaccatcagccgcatcgcc
gtctcctaccagaccaaggtcaacctcctctctgccatcaagagcccctgccagagggag
accccagagggggctgaggccaagccctggtatgagcccatctatctgggaggggtcttc
cagctggagaagggtgaccgactcagcgctgagatcaatcggcccgactatctcgacttt
gccgagtctgggcaggtctactttgggatcattgccctgtga |