KEGG   Homo sapiens (human): 7295
Entry
7295              CDS       T01001                                 

Gene name
TXN, TRDX, TRX, TRX1, Trx80
Definition
(RefSeq) thioredoxin
  KO
K03671  thioredoxin 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
hsa05012  Parkinson disease
hsa05132  Salmonella infection
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06440  Transcription
nt06463  Parkinson disease
  Element
N01059  Mutation-inactivated DJ1 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    7295 (TXN)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    7295 (TXN)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    7295 (TXN)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    7295 (TXN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    7295 (TXN)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Protein disulfide isomerase
   7295 (TXN)
SSDB
Motif
Pfam: Thioredoxin DIM1 Thioredoxin_8 Thioredoxin_7 Thioredoxin_2 OST3_OST6 Thioredoxin_9 Glutaredoxin AhpC-TSA Redoxin
Other DBs
NCBI-GeneID: 7295
NCBI-ProteinID: NP_003320
OMIM: 187700
HGNC: 12435
Ensembl: ENSG00000136810
Vega: OTTHUMG00000020480
Pharos: P10599(Tchem)
UniProt: P10599 H9ZYJ2
Structure
PDB: 

Position
9q31.3
AA seq 105 aa
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVD
DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
NT seq 318 nt   +upstreamnt  +downstreamnt
atggtgaagcagatcgagagcaagactgcttttcaggaagccttggacgctgcaggtgat
aaacttgtagtagttgacttctcagccacgtggtgtgggccttgcaaaatgatcaagcct
ttctttcattccctctctgaaaagtattccaacgtgatattccttgaagtagatgtggat
gactgtcaggatgttgcttcagagtgtgaagtcaaatgcatgccaacattccagtttttt
aagaagggacaaaaggtgggtgaattttctggagccaataaggaaaagcttgaagccacc
attaatgaattagtctaa

DBGET integrated database retrieval system