KEGG   Homo sapiens (human): 79797
Entry
79797             CDS       T01001                                 
Symbol
ZNF408, EVR6, RP72
Name
(RefSeq) zinc finger protein 408
  KO
K24372  zinc finger protein 408
Organism
hsa  Homo sapiens (human)
Disease
H00527  Retinitis pigmentosa
H00589  Familial exudative vitreoretinopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    79797 (ZNF408)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    79797 (ZNF408)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-C2H2_11 zf-Di19 zf-met Zn-ribbon_8 zf-C2HE DZR HVO_2753_ZBP Zn_ribbon_SprT GAGA
Other DBs
NCBI-GeneID: 79797
NCBI-ProteinID: NP_079017
OMIM: 616454
HGNC: 20041
Ensembl: ENSG00000175213
Pharos: Q9H9D4(Tdark)
UniProt: Q9H9D4
Position
11:46701031..46705912
AA seq 720 aa
MEEAEELLLEGKKALQLAREPRLGLDLGWNPSGEGCTQGLKDVPPEPTRDILALKSLPRG
LALGPSLAKEQRLGVWCVGDPLQPGLLWGPLEEESASKEKGEGVKPRQEENLSLGPWGDV
CACEQSSGWTSLVQRGRLESEGNVAPVRISERLHLQVYQLVLPGSELLLWPQPSSEGPSL
TQPGLDKEAAVAVVTEVESAVQQEVASPGEDAAEPCIDPGSQSPSGIQAENMVSPGLKFP
TQDRISKDSQPLGPLLQDGDVDEECPAQAQMPPELQSNSATQQDPDGSGASFSSSARGTQ
PHGYLAKKLHSPSDQCPPRAKTPEPGAQQSGFPTLSRSPPGPAGSSPKQGRRYRCGECGK
AFLQLCHLKKHAFVHTGHKPFLCTECGKSYSSEESFKAHMLGHRGVRPFPCPQCDKAYGT
QRDLKEHQVVHSGARPFACDQCGKAFARRPSLRLHRKTHQVPAAPAPCPCPVCGRPLANQ
GSLRNHMRLHTGEKPFLCPHCGRAFRQRGNLRGHLRLHTGERPYRCPHCADAFPQLPELR
RHLISHTGEAHLCPVCGKALRDPHTLRAHERLHSGERPFPCPQCGRAYTLATKLRRHLKS
HLEDKPYRCPTCGMGYTLPQSLRRHQLSHRPEAPCSPPSVPSAASEPTVVLLQAEPQLLD
THREEEVSPARDVVEVTISESQEKCFVVPEEPDAAPSLVLIHKDMGLGAWAEVVEVEMGT
NT seq 2163 nt   +upstreamnt  +downstreamnt
atggaggaggcggaggagctgctcttggaggggaagaaggcgctgcaactcgcccgcgag
ccgcgcctgggcctggacttaggatggaacccttccggagaaggctgtacgcagggcctc
aaagacgtcccacccgagccgacccgagacatcctcgctttaaagagccttccccggggc
ttggcccttggcccctcactcgccaaggaacagcgcttgggggtctggtgtgtcggggac
cccctgcagcccggcctgctgtgggggccgctggaagaggagtctgcctccaaggagaag
ggcgagggagtaaagccacggcaggaggagaacctgtcattaggcccatggggagacgtg
tgtgcctgtgagcagagttctggctggactagcttggtacaacggggcaggctggagagt
gagggaaatgtggccccagtgcggatcagcgagaggcttcatctgcaagtgtaccagctg
gtgctgccaggctctgaactgctgctgtggccccagccttcctctgagggcccaagtctc
acccagcctgggctggacaaagaggcagctgtagcagtggtgacagaagtggagtctgct
gtacagcaggaagtggcctcccctggggaggatgcagcagaaccttgcatagatcctggt
tcccagtcaccctctggcatccaggcagagaatatggtgagccctggacttaagttccca
acccaggaccgaatttccaaggatagccagccacttggcccattgcttcaggatggcgac
gtggatgaggaatgcccggcccaggcacagatgccacctgaacttcagagcaattcggct
acccagcaggacccagatggcagtggagccagtttctcatcttctgccaggggcacccag
ccgcatggctacctggccaagaagttacacagccccagtgatcagtgcccacccagagca
aagaccccagagcctggagcccagcagtctggcttccctacactctcgcggagccctcct
ggcccagcaggaagctccccaaagcaggggcgacggtaccggtgtggagagtgtggcaag
gcattcctacagctgtgccacctaaagaagcacgcatttgtgcacacgggccacaagccc
tttctttgcactgagtgtggcaagagctatagctcagaggagagcttcaaagcccatatg
ctgggccaccgtggggtgcggcccttcccctgtccacaatgcgacaaggcctatggcacc
cagcgagacctcaaagagcaccaggtggtacattcaggtgcccggccctttgcttgtgac
cagtgtggcaaggcctttgcccgccggccctccctgcggctgcatcgcaagacccaccag
gtgccagctgcccctgccccttgcccatgccctgtgtgtgggcggcccctggccaaccag
ggctccctgcggaaccatatgaggctccatacaggagaaaagcctttcctgtgcccgcac
tgtggccgggcgtttcgtcagcggggcaacctgcgtgggcatttgcggctccacaccggg
gagcgtccttaccgctgcccacactgtgccgatgccttcccccagctgcctgaactgcgg
cgccatctcatctcacacaccggggaggcccacttgtgcccggtgtgtggcaaggccctc
cgagacccacacacgctccgagctcacgagcgcctgcactccggagagaggccctttccc
tgtccccagtgtggccgtgcttacacgctggccaccaagctgcggcgccacctcaaatct
cacttggaggacaagccctaccgctgccccacctgtggcatgggctacaccctcccgcag
agcctcaggcggcatcagctcagtcaccggcctgaggcaccctgcagcccaccctctgtg
ccttctgctgcttctgagcccactgtggtgctcctgcaggctgagccacaactgctggac
acacacagagaggaggaagtctcccccgccagggatgttgttgaggtcaccatttcagaa
agccaggagaagtgctttgtggtgccagaggagccagatgccgcccccagcctggtgcta
atccataaggacatgggcctcggcgcctgggcagaggtggtggaggtggagatgggcacc
tga

DBGET integrated database retrieval system