KEGG   Homo sapiens (human): 83959
Entry
83959             CDS       T01001                                 
Symbol
SLC4A11, BTR1, CDPD1, CHED, CHED2, NABC1, dJ794I6.2
Name
(RefSeq) solute carrier family 4 member 11
  KO
K13862  solute carrier family 4 (sodium borate transporter), member 11
Organism
hsa  Homo sapiens (human)
Disease
H00960  Fuchs corneal dystrophy
H00963  Congenital hereditary endothelial dystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    83959 (SLC4A11)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   83959 (SLC4A11)
SSDB
Motif
Pfam: HCO3_cotransp Band_3_cyto PTS_EIIA_2
Other DBs
NCBI-GeneID: 83959
NCBI-ProteinID: NP_001167560
OMIM: 610206
HGNC: 16438
Ensembl: ENSG00000088836
Pharos: Q8NBS3(Tbio)
UniProt: Q8NBS3
Position
20:complement(3227417..3239559)
AA seq 875 aa
MAAATRRVFHLQPCENSPTMSQNGYFEDSSYYKCDTDDTFEAREEILGDEAFDTANSSIV
SGESIRFFVNVNLEMQATNTENEATSGGCVLLHTSRKYLKLKNFKEEIRAHRDLDGFLAQ
ASIVLNETATSLDNVLRTMLRRFARDPDNNEPNCNLDLLMAMLFTDAGAPMRGKVHLLSD
TIQGVTATVTGVRYQQSWLCIICTMKALQKRHVCISRLVRPQNWGENSCEVRFVILVLAP
PKMKSTKTAMEVARTFATMFSDIAFRQKLLETRTEEEFKEALVHQRQLLTMVSHGPVAPR
TKERSTVSLPAHRHPEPPKCKDFVPFGKGIREDIARRFPLYPLDFTDGIIGKNKAVGKYI
TTTLFLYFACLLPTIAFGSLNDENTDGAIDVQKTIAGQSIGGLLYALFSGQPLVILLTTA
PLALYIQVIRVICDDYDLDFNSFYAWTGLWNSFFLALYAFFNLSLVMSLFKRSTEEIIAL
FISITFVLDAVKGTVKIFWKYYYGHYLDDYHTKRTSSLVSLSGLGASLNASLHTALNASF
LASPTELPSATHSGQATAVLSLLIMLGTLWLGYTLYQFKKSPYLHPCVREILSDCALPIA
VLAFSLISSHGFREIEMSKFRYNPSESPFAMAQIQSLSLRAVSGAMGLGFLLSMLFFIEQ
NLVAALVNAPENRLVKGTAYHWDLLLLAIINTGLSLFGLPWIHAAYPHSPLHVRALALVE
ERVENGHIYDTIVNVKETRLTSLGASVLVGLSLLLLPVPLQWIPKPVLYGLFLYIALTSL
DGNQLVQRVALLLKEQTAYPPTHYIRRVPQRKIHYFTGLQVLQLLLLCAFGMSSLPYMKM
IFPLIMIAMIPIRYILLPRIIEAKYLDVMDAEHRP
NT seq 2628 nt   +upstreamnt  +downstreamnt
atggccgcggccaccaggcgcgtgttccatctgcagccgtgcgaaaactctcccaccatg
tcgcagaatggatacttcgaggattcaagctactacaagtgtgacacagatgacaccttc
gaagcccgagaggagatcctgggggatgaggccttcgacactgccaactcctccatcgtg
tctggcgagagtatccgtttttttgtcaatgtcaaccttgagatgcaggccaccaacact
gagaatgaagcgacttccggtggctgtgtgctcctgcacacctcccgaaagtacctgaag
ttaaagaacttcaaggaagagatccgtgcgcaccgcgacctagatggcttcctggcgcag
gccagcatcgtcctgaacgagacggccacctccctggataacgtgctgcggaccatgctt
cgccgcttcgccagggaccctgacaacaatgagcccaactgcaacctggacctgctcatg
gccatgctcttcaccgatgccggggcacccatgcggggtaaagtccacctgctgtcagat
accatccaaggggtcaccgccacagtgacaggggtgcggtaccagcagtcgtggctctgc
atcatctgtaccatgaaggccctacagaagcggcacgtgtgcatcagccgcctggttcgc
ccacagaactggggggagaattcctgtgaggttcggttcgtcatcctggtgctggcccca
cccaagatgaaaagcactaagactgcgatggaggtggcgcgcacgtttgccaccatgttc
tcggatatcgccttccgccagaagctcctggagacccgcacagaggaggaattcaaggag
gccttggtgcatcagagacagctgctcaccatggtgagccacggtccagtggcgccgaga
acgaaggaacgcagcacagtctccctccctgcccacagacacccagagcccccaaagtgc
aaggactttgtcccttttgggaagggcatccgggaggacatcgcacgcaggttccccttg
taccccttggacttcactgatggcattattgggaaaaacaaggctgtgggcaaatacatc
accaccaccctgttcctctacttcgcctgcctcctgcccaccatcgctttcgggtctctc
aatgacgagaacacagacggggccatcgacgtgcagaagaccatagccgggcagagcatc
gggggcctgctctacgcgctcttctctgggcagccattggtgattctgctgaccaccgcg
cccctggcgctctacatccaggtgattcgtgtcatctgtgatgactatgacctggacttc
aactccttctacgcatggacgggcctgtggaatagtttcttccttgcgctttatgccttt
ttcaacctcagcctggtcatgagtctcttcaagaggtcgacggaggagatcatcgccctc
ttcatttccatcacgtttgtgctggatgccgtcaagggcacggttaaaatcttctggaag
tactactatgggcattacttggacgactatcacacaaaaaggacttcatcccttgtcagc
ctgtcaggcctcggcgccagcctcaacgccagcctccacactgccctcaacgccagcttc
ctcgccagccccacggagctgccctcggccacacactcaggccaggcgaccgccgtgctc
agcctcctcatcatgctgggcacgctctggctgggctacaccctctaccaattcaagaag
agcccctacctgcacccctgcgtgcgagagatcctgtccgactgcgccctgcccatcgcg
gtgctcgccttctccctcatcagctcccatggcttccgggaaatcgagatgagcaagttc
cgctacaaccccagcgagagcccctttgcgatggcgcagatccagtcgctgtccctgagg
gccgtcagcggtgccatgggcctcggcttcctgctgtccatgctcttcttcatcgagcag
aacttggtggccgccttggtgaatgcaccggagaacaggctggtgaagggcactgcctac
cactgggacctcctgctcctcgccatcatcaacacagggctgtctctgtttgggctgcct
tggatccatgccgcctacccccactccccgctgcacgtgcgagccctggccttagtggag
gagcgtgtggagaacggacacatctatgacacgattgtgaacgtgaaggagacgcggctg
acctcgctgggcgccagcgtcctggtgggcctgtccctgttgctgctgccggtcccgctt
cagtggatccccaagcccgtgctctatggcctcttcctctacatcgcgctcacctccctc
gatggcaaccagctcgtccagcgcgtggccctgctgctcaaggagcagactgcgtacccc
ccgacacactacatccggagggtgccccagaggaagatccactacttcacgggcctgcag
gtgcttcagctgctgctgctgtgtgccttcggcatgagctccctgccctacatgaagatg
atctttcccctcatcatgatcgccatgatccccatccgctatatcctgctgccccgaatc
attgaagccaagtacttggatgtcatggacgctgagcacaggccttga

DBGET integrated database retrieval system