KEGG   Homo sapiens (human): 84172
Entry
84172             CDS       T01001                                 

Gene name
POLR1B, A135, RPA135, RPA2, Rpo1-2, TCS4
Definition
(RefSeq) RNA polymerase I subunit B
  KO
K03002  DNA-directed RNA polymerase I subunit RPA2 [EC:2.7.7.6]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    84172 (POLR1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    84172 (POLR1B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     84172 (POLR1B)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase I system
   RNA polymerase I
    Core subunits
     84172 (POLR1B)
SSDB
Motif
Pfam: RNA_pol_Rpb2_6 RNA_pol_Rpb2_1 RNA_pol_Rpb2_3 RNA_pol_Rpb2_7 RNA_pol_Rpa2_4 RNA_pol_Rpb2_2 DUF1186
Other DBs
NCBI-GeneID: 84172
NCBI-ProteinID: NP_061887
OMIM: 602000
HGNC: 20454
Ensembl: ENSG00000125630
Vega: OTTHUMG00000131314
Pharos: Q9H9Y6(Tbio)
UniProt: Q9H9Y6 B7Z1W6
Position
2q14.1
AA seq 1135 aa
MDPGSRWRNLPSGPSLKHLTDPSYGIPREQQKAALQELTRAHVESFNYAVHEGLGLAVQA
IPPFEFAFKDERISFTILDAVISPPTVPKGTICKEANVYPAECRGRRSTYRGKLTADINW
AVNGISKGIIKQFLGYVPIMVKSKLCNLRNLPPQALIEHHEEAEEMGGYFIINGIEKVIR
MLIMPRRNFPIAMIRPKWKTRGPGYTQYGVSMHCVREEHSAVNMNLHYLENGTVMLNFIY
RKELFFLPLGFALKALVSFSDYQIFQELIKGKEDDSFLRNSVSQMLRIVMEEGCSTQKQV
LNYLGECFRVKLNVPDWYPNEQAAEFLFNQCICIHLKSNTEKFYMLCLMTRKLFALAKGE
CMEDNPDSLVNQEVLTPGQLFLMFLKEKLEGWLVSIKIAFDKKAQKTSVSMNTDNLMRIF
TMGIDLTKPFEYLFATGNLRSKTGLGLLQDSGLCVVADKLNFIRYLSHFRCVHRGADFAK
MRTTTVRRLLPESWGFLCPVHTPDGEPCGLMNHLTAVCEVVTQFVYTASIPALLCNLGVT
PIDGAPHRSYSECYPVLLDGVMVGWVDKDLAPGIADSLRHFKVLREKRIPPWMEVVLIPM
TGKPSLYPGLFLFTTPCRLVRPVQNLALGKEELIGTMEQIFMNVAIFEDEVFAGVTTHQE
LFPHSLLSVIANFIPFSDHNQSPRNMYQCQMGKQTMGFPLLTYQDRSDNKLYRLQTPQSP
LVRPSMYDYYDMDNYPIGTNAIVAVISYTGYDMEDAMIVNKASWERGFAHGSVYKSEFID
LSEKIKQGDSSLVFGIKPGDPRVLQKLDDDGLPFIGAKLQYGDPYYSYLNLNTGESFVMY
YKSKENCVVDNIKVCSNDTGSGKFKCVCITMRVPRNPTIGDKFASRHGQKGILSRLWPAE
DMPFTESGMVPDILFNPHGFPSRMTIGMLIESMAGKSAALHGLCHDATPFIFSEENSALE
YFGEMLKAAGYNFYGTERLYSGISGLELEADIFIGVVYYQRLRHMVSDKFQVRTTGARDR
VTNQPIGGRNVQGGIRFGEMERDALLAHGTSFLLHDRLFNCSDRSVAHVCVKCGSLLSPL
LEKPPPSWSAMRNRKYNCTLCSRSDTIDTVSVPYVFRYFVAELAAMNIKVKLDVV
NT seq 3408 nt   +upstreamnt  +downstreamnt
atggatcctggcagccggtggcggaacctgcccagcgggcctagcctaaagcacttgact
gacccctcttatggaatcccgcgggaacagcaaaaggcagcgttgcaggagctgacgcgg
gcgcacgtggagtccttcaactacgctgtgcacgagggtctcggcctcgcggtgcaggct
atacctccctttgaatttgctttcaaagatgagcgtatctcttttactattctggatgct
gttatcagtccacctacagttccaaaagggaccatctgcaaagaggccaatgtttatcca
gcagaatgccggggccgaaggagtacctaccgtgggaagttgacagctgatatcaactgg
gcagtgaatggaatctcaaaaggaatcattaagcagtttcttggctatgttcccatcatg
gtgaaatccaagctttgcaacttacgtaaccttcccccacaagccctcattgagcaccat
gaggaggcagaggaaatggggggctattttataatcaatggcattgaaaaagtcatccga
atgttgattatgcctcggagaaattttcccattgcaatgataagaccaaaatggaaaacc
agagggcctggttatactcagtatggagtttcaatgcactgtgtgagggaagaacattcc
gctgtcaatatgaacctccactacttggaaaatggcactgttatgttgaactttatttac
cgaaaagaactgttctttcttcctttgggatttgcacttaaggcacttgtcagcttttct
gattatcagatctttcaggagctcatcaaaggaaaagaggatgattctttccttaggaac
tctgtttctcagatgttaaggattgtaatggaagagggttgttcgacacaaaaacaggtc
cttaactacctaggtgaatgcttcagagtaaaactcaatgttcctgactggtacccaaat
gagcaagctgcggagttcctgtttaaccagtgcatctgtatccacttgaaatccaatact
gaaaagttttatatgctttgtctcatgacgcgaaagctctttgctttagccaaaggagag
tgcatggaggacaatcctgatagtttggtgaaccaggaagtcctcacaccgggtcagctc
ttccttatgttcctgaaggaaaaactggaaggttggttagtgtctattaaaatagctttt
gataagaaggctcagaagaccagtgtttccatgaacactgacaatttgatgaggattttt
acaatgggcatagaccttacaaaaccatttgaatacctttttgctactgggaatctgcgt
tctaaaacaggtcttggcctcctacaagattctggactttgtgttgtggctgacaagctg
aacttcatacgctacctctcccatttccgctgcgtgcacagaggggctgattttgccaag
atgaggaccaccacagtacgcaggctgctgccagagtcctggggcttcctttgtcccgtg
cataccccagacggggagccctgtggcctgatgaaccacctaactgccgtatgtgaggtt
gtcacacagtttgtgtatacggcatctattccagctttactgtgcaacttgggggtcact
cccattgatggagctccccaccgatcatacagtgagtgctaccctgtcctgctggacggt
gtcatggttggctgggtggataaggatcttgctccaggcatcgcagattctcttcgtcat
tttaaggtgttgagagagaaaagaattcctccctggatggaagtggtccttatacccatg
acaggaaaaccaagtctgtacccaggattgttcctttttaccactccttgtagactggta
cggcctgtgcagaacttagcattgggcaaagaagagctaattggaactatggaacagatc
ttcatgaatgtcgctatctttgaggatgaagtttttgctggagttaccacacaccaggaa
ctctttccacacagcctgctgagtgtgattgccaacttcatccctttctctgatcacaac
cagagtccacggaacatgtaccaatgccagatgggtaagcaaactatgggctttccactt
ctcacttatcaagaccgatcggataacaaactgtatcgtcttcagactcctcagagtccc
ttggtgagaccctccatgtatgattattatgacatggataactatccaattgggaccaat
gccatcgttgctgtgatttcttacactggctatgatatggaagatgccatgattgtgaat
aaggcctcttgggaacgaggctttgcccatggaagtgtctacaagtctgagttcatagac
ctctctgaaaaaattaaacaaggagatagtagcctggtgtttggcatcaaacctggtgac
ccacgcgttctgcagaagttagatgacgatggattgccgtttataggagcaaaactgcag
tacggagatccgtattacagctacctcaacctcaacaccggggaaagttttgtgatgtac
tataagagtaaagaaaattgtgttgtggataacatcaaagtgtgcagtaatgacactggg
agtggaaaattcaagtgtgtttgcatcactatgagagtgcctcggaacccaactatcgga
gataaatttgccagtcgccatgggcagaagggcattttaagcagattgtggccggctgag
gacatgccttttactgagagtgggatggtcccagacattctgttcaatccccatggtttt
ccatcccgcatgaccattgggatgttaattgagagtatggccgggaagtctgcagctttg
catggtctctgccatgatgctacacccttcatcttctcagaggagaactcggccttagaa
tactttggtgagatgttaaaggctgctggctacaatttctatggcaccgagaggttatat
agtggcatcagtgggctagaactggaagcagacatcttcataggagtggtttattatcag
cgcttacgccatatggtctcagacaaatttcaagtaaggacaactggagcccgagacaga
gtcaccaaccagcctattgggggaagaaatgtccagggtggaatccgttttggggagatg
gaacgggatgcgcttttagctcatggtacatcttttctccttcatgaccgcctcttcaac
tgctcagatcggtcggtagcccatgtgtgtgtgaagtgtggcagtttactctctccactg
ttggagaagccacccccttcttggtctgccatgcgcaacagaaaatacaactgtactctg
tgtagtcgcagtgacactatcgatactgtttctgtgccttatgtttttcggtattttgta
gctgaactggcagctatgaacatcaaagtgaaactggatgttgtttaa

DBGET integrated database retrieval system