KEGG   Iodobacter fluviatilis: C1H71_10080
Entry
C1H71_10080       CDS       T06803                                 

Name
(GenBank) monooxygenase
  KO
K20090  violacein synthase [EC:1.14.13.224]
Organism
ifl  Iodobacter fluviatilis
Pathway
ifl00404  Staurosporine biosynthesis
ifl01100  Metabolic pathways
ifl01110  Biosynthesis of secondary metabolites
ifl02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ifl00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00404 Staurosporine biosynthesis
    C1H71_10080
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    C1H71_10080
Enzymes [BR:ifl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.224  violacein synthase
     C1H71_10080
SSDB
Motif
Pfam: FAD_binding_3 Trp_halogenase NAD_binding_8 DAO Pyr_redox Pyr_redox_2 SE FAD_binding_2 GIDA HI0933_like FAD_oxidored Filo_VP24 Sdh5 ApbA Thi4 AlaDh_PNT_C
Other DBs
NCBI-ProteinID: QBC43862
UniProt: A0A7G3G9W2
Position
2216962..2218251
AA seq 429 aa
MKKIIIVGGGLAGGLAAIYLAKRGHDVHVFEKRGDPFLAYSDYIDQVSSRAIGVSMTVRG
IQAVLNAGIPKEELDLCGIPITGMSFCIAGKFKTRELPAIDSLSPLSLSRADFQKLLNKY
AVINNVHYHYGQRCLEVNLDDKTITTKDNNGLIVEHKGDLLIGADGARSAVRQAMQNNIR
RFEYQQSFFKHGYKTLVIADASPLNLRKDLIYFFGMDSGGIFAGRAATIPDGSISFAVCL
PYQGEISLNTKDSAIMGRFFDKYYAMLPEETRKELLSQFIEKPSNDLINVKSSVFHYKQN
ALILGDSAHATAPFLGQGMNMALEDAYILNALFEKHEDDFEKILPEFTQLRKVEADAMQE
MAINNYEVLSRSNPIFFMRSKYTRYMSNKFPARYPPDMAEKLYFTSMAYRELRDIQQKQN
VWYKLGRVN
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgaagaaaataattattgtgggggggggcttagcaggtggtttggccgccatttattta
gctaaacgtgggcatgatgtgcatgtttttgaaaaacgtggcgatccttttttggcgtat
tcagattatatagatcaagttagctcgcgggcgataggcgtgagtatgacggtgcgtggg
attcaagcggttttaaatgcaggtattcctaaagaagagttagatttatgtgggattcct
atcactggcatgtctttttgtattgctggaaaatttaaaaccagagaattgcccgccatt
gattctctttcgcctctttcattaagcagggcggattttcagaaattattaaataaatat
gcagttattaataatgttcattatcactatggtcaacgatgcttagaagttaatttagat
gataaaacaatcaccactaaagataataatgggctgattgttgagcataagggcgatcta
ttgattggtgcagatggagcacgctctgctgtgcggcaagctatgcaaaataatatccgc
agatttgaatatcagcaatcatttttcaaacatggatataaaacactcgttatcgcagat
gccagcccgcttaatttaagaaaagatttaatctatttttttggaatggattctggcggt
atatttgctgggcgtgcagctaccattcctgatggcagtattagctttgcagtttgttta
ccttatcagggggagattagtttaaatactaaagacagcgcaattatggggcgctttttt
gataagtactatgcaatgctgcctgaagaaactagaaaagaactgctatcacagtttata
gaaaagccaagtaatgatttgattaatgtaaaatcttcagtttttcattataagcaaaat
gcattaattctgggagattcagcccatgccactgcgccttttctggggcagggaatgaat
atggcgttagaagacgcttatatcttgaatgcattattcgaaaagcatgaggatgatttt
gaaaaaattctgcctgaattcactcagttaaggaaagttgaggccgatgcaatgcaagag
atggccattaataattatgaagtgctgagtcggtctaaccctattttctttatgcgctca
aaatatactcgttatatgagtaataaattccctgcccgctatcctccggatatggctgaa
aagctttatttcacctcgatggcttatcgggagctaagagatattcagcagaagcaaaat
gtttggtacaaactagggagagtcaactaa

DBGET integrated database retrieval system