KEGG   Janthinobacterium agaricidamnosum: GJA_1082
Entry
GJA_1082          CDS       T03157                                 

Symbol
vioC
Name
(GenBank) putative monooxygenase vioC
  KO
K20090  violacein synthase [EC:1.14.13.224]
Organism
jag  Janthinobacterium agaricidamnosum
Pathway
jag00404  Staurosporine biosynthesis
jag01100  Metabolic pathways
jag01110  Biosynthesis of secondary metabolites
jag02024  Quorum sensing
Module
jag_M00808  Violacein biosynthesis, tryptophan => violacein
Brite
KEGG Orthology (KO) [BR:jag00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00404 Staurosporine biosynthesis
    GJA_1082 (vioC)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    GJA_1082 (vioC)
Enzymes [BR:jag01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.224  violacein synthase
     GJA_1082 (vioC)
SSDB
Motif
Pfam: FAD_binding_3 Trp_halogenase DAO Pyr_redox_2 NAD_binding_8 GIDA Pyr_redox SE FAD_binding_2 HI0933_like FAD_oxidored Thi4 AlaDh_PNT_C 3HCDH_N ApbA NRho Pyr_redox_3 TrkA_N
Other DBs
NCBI-ProteinID: CDG81737
UniProt: W0V386
Position
1201820..1203109
AA seq 429 aa
MHKIIIVGGGLAGSLAAIYLAQRGHQVQVIEKRADPLLENSAGADPVSSRAIGVSMTVRG
IKAVLGAGIDKQELYRCGEPIVGMAFSVGGRYRVRELSSLEGMFPLSLDRTAFQRLLNRY
AAMHQVTYHFEHKCLDVDLERKVVLIQGRDGALQHLHGDLIIGADGAHSAVRSAMQSGMR
RFEFKQSFFRHGYKTVVLPNAAELGYRKDLLYFFGMDSKGLFAGRAATIPDGSISFAICL
PYSGTPSLATHDREAMAGFFSRYFGGLPPASRQEMLDQFIALPSNDLINVRSSTFHYKGN
VLLIGDAAHATAPFLGQGMNMALEDVHVFINLLEQHGDALRLALSEFTRQRKVQADAMQD
MAIANYETLSNPNLMFFLQTRYTRYMHKRFPHVYPPDMAEKLYFTSVPYDELQQIQKKQN
VWYKLGRVN
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgcacaaaatcatcatcgttggcggcggcctggcgggcagccttgccgccatctatctg
gcgcaacgcggacatcaggtccaggtcattgaaaagcgcgccgatccgctgctggaaaat
tcagccggcgccgatccggtcagctcgcgcgccatcggcgtcagcatgacagtgcgcggc
atcaaggcggtactgggggccggcatcgataagcaggagttgtaccggtgtggcgagccc
atcgtcggcatggcgttttcggtcggcggccgctacagggtacgcgagttgagctcgctc
gaaggcatgttcccgctgtcgctggaccggaccgcgttccagcggctgttaaaccgatac
gccgccatgcatcaggtgacctatcactttgagcataaatgcctggatgtcgacctggaa
aggaaagtcgtgctgatccagggacgggacggcgcattgcagcatctgcatggcgacctg
atcatcggcgccgacggcgctcattcggcggtgcgcagcgcgatgcaaagcggcatgcgg
cgcttcgagttcaagcagagtttttttcgccatggctacaagacggtggtgttgccgaat
gccgccgagctcggctacaggaaggatctgctgtatttcttcggcatggattccaagggc
ctgtttgccggccgcgccgccaccatcccggacggcagcatcagcttcgcgatttgcctg
ccttactcgggcacgcccagcctggccacgcatgaccgggaagccatggcaggcttcttc
agccgctacttcggcggcctgccgccggccagccggcaagagatgctggaccagttcatc
gcgctgcccagcaacgacctgatcaatgtccgctccagtacctttcattacaagggcaat
gtcttgctgatcggcgatgcggcgcatgctaccgcccctttcctcgggcagggcatgaac
atggcgctggaagacgtccacgttttcattaatttactggaacagcacggcgatgcgctg
cgcctggcattgtccgagttcacccgccagcgcaaggtgcaggcggacgcgatgcaggat
atggcgatcgccaactacgaaacgctgagcaacccgaatctgatgtttttcctgcaaacc
cgctacacccgctacatgcacaagagatttccgcatgtttatccgcccgacatggcggaa
aaactgtatttcacatcggttccctacgatgagctgcagcagatccagaagaagcaaaac
gtttggtataaactcgggagggtcaattaa

DBGET integrated database retrieval system