KEGG   Janthinobacterium sp. LM6: BZG29_16955
Entry
BZG29_16955       CDS       T04756                                 

Name
(GenBank) monooxygenase
  KO
K20090  violacein synthase [EC:1.14.13.224]
Organism
jal  Janthinobacterium sp. LM6
Pathway
jal00404  Staurosporine biosynthesis
jal01100  Metabolic pathways
jal01110  Biosynthesis of secondary metabolites
jal02024  Quorum sensing
Module
jal_M00808  Violacein biosynthesis, tryptophan => violacein
Brite
KEGG Orthology (KO) [BR:jal00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00404 Staurosporine biosynthesis
    BZG29_16955
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BZG29_16955
Enzymes [BR:jal01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.224  violacein synthase
     BZG29_16955
SSDB
Motif
Pfam: FAD_binding_3 Trp_halogenase DAO Pyr_redox_2 NAD_binding_8 GIDA FAD_binding_2 SE Pyr_redox HI0933_like FAD_oxidored 3HCDH_N ApbA TrkA_N AlaDh_PNT_C Sacchrp_dh_NADP UDPG_MGDP_dh_N
Other DBs
NCBI-ProteinID: AQR69823
UniProt: A0A1S6F8J6
Position
3862662..3863951
AA seq 429 aa
MHKIIIVGGGLAGSLSAIYLAQRGHDVHVVEKRGDPLQKASATADPVNSRAIGVTMTVRG
VKAVLAAGIDRQELERCGERILGMAFSVGGKFKVRELSQREGLFPLSLDRSAFQRLLNTY
AARHEVKYYFEHKCLDVDLERKVVLIQGQDGAVQQLHGDLIIGADGAHSAVRRAMQSGMR
RFEFKQSFFRHGYKTLVLPNAEGLGFRKDLLYFFGMDSKGQFAGRAATIPNGSISFVICL
PYSGTPSLNTLNRETMAAFFDRYYDKLPAASRQEMVNQFIALPSNDLINVRSSTFHYKDH
VLLIGDAAHATAPFLGQGMNMALEDSYIFATLLEKHGNALAPTLAEFTQQRKVQADAMQD
MAIANYEALSNPSLIFFLQTRYNRFMHQKFPRIYPPDMADKLFFTSIPYDELQQIQRKQN
VWYKLGRVN
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgcataaaatcattatcgtcggcggaggcctggcaggtagcctcagcgccatttatctg
gcgcaacgggggcacgatgtccacgtggtcgaaaaacggggcgatccgctgcagaaagcg
tccgcaaccgccgatcccgtcaactcgcgcgccatcggcgtcaccatgaccgtgcgcggc
gtcaaggccgtgctggcggccggcatcgacaggcaggagctggagcggtgcggcgaacgc
atcctgggcatggcgttttccgtcggcggcaaattcaaggtgcgcgaactgagccagcgc
gaaggcctgtttccgctgtcgctggaccggtccgcgttccagcgcctgttaaacacctac
gccgccaggcacgaagtgaaatactactttgagcataaatgcctggatgtcgacctggaa
aggaaggtcgtgctgatccaggggcaggacggcgccgtgcagcagctacatggcgacctg
atcatcggtgccgacggcgcccattccgcggtgcggcgcgccatgcagagcggcatgcgg
cgcttcgagttcaagcaaagcttctttcgccatggctacaagaccctcgtgttgccgaat
gcggagggcctgggtttcaggaaggatttgctgtatttcttcggcatggactccaagggc
cagtttgccggccgcgcagccaccatcccgaacggcagcatcagcttcgtcatttgcctg
ccctactccggcacaccgagcttgaacacgctgaaccgggaaaccatggcggccttcttc
gaccgctattacgacaagctgccggcggccagccggcaagagatggtgaaccagtttatc
gccctgcccagcaatgacctcatcaatgtccgctccagcaccttccactacaaggaccat
gtcctgctgatcggcgatgcggcgcatgccacggccccgttcctcggccagggcatgaac
atggcgctggaagacagctatatcttcgccacgttgctggaaaagcatggcaatgcgctg
gcgcctaccctggccgagttcacgcagcagcgcaaggtgcaggcggacgccatgcaggat
atggcgatcgccaactacgaagcgctgagcaaccccagcctgattttcttcctgcagacg
cgctacaaccgcttcatgcaccagaaatttccccgtatttatccaccggacatggcggat
aaattgttttttacatcgattccttacgatgaactgcagcagatccagaggaagcaaaac
gtttggtataaacttgggagggtaaattaa

DBGET integrated database retrieval system