KEGG   Janthinobacterium sp. 1_2014MBL_MicDiv: YQ44_10560
Entry
YQ44_10560        CDS       T04539                                 

Name
(GenBank) monooxygenase
  KO
K20090  violacein synthase [EC:1.14.13.224]
Organism
jaz  Janthinobacterium sp. 1_2014MBL_MicDiv
Pathway
jaz00404  Staurosporine biosynthesis
jaz01100  Metabolic pathways
jaz01110  Biosynthesis of secondary metabolites
jaz02024  Quorum sensing
Module
jaz_M00808  Violacein biosynthesis, tryptophan => violacein
Brite
KEGG Orthology (KO) [BR:jaz00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00404 Staurosporine biosynthesis
    YQ44_10560
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    YQ44_10560
Enzymes [BR:jaz01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.224  violacein synthase
     YQ44_10560
SSDB
Motif
Pfam: FAD_binding_3 Trp_halogenase DAO Pyr_redox_2 NAD_binding_8 FAD_binding_2 SE GIDA Pyr_redox HI0933_like FAD_oxidored 3HCDH_N ApbA Sacchrp_dh_NADP TrkA_N AlaDh_PNT_C UDPG_MGDP_dh_N
Other DBs
NCBI-ProteinID: APA68194
UniProt: A0A1I9XWQ2
Position
complement(2431530..2432819)
AA seq 429 aa
MHKIIIVGGGLAGSLSAIYLAQRGHDVHVVEKRGDPLQKASANADPVNSRAIGVTMTVRG
VKAVLAAGISRQELELCGERILGMAFSVGRTFKVRELPQREGLFPLSLDRSAFQRLLNTY
AARHEVKYYFEHKCLDVDLERKVVLVQGPDGALQHLHGDLIIGADGAHSAVRRAMQSGMR
RFEFKQSFFRHGYKTLVLPNAEGLGFRKDLLYFFGMASKGQFAGRAATIPDGSVSFVICL
PYSGTPSLNTLNRETMAAFFDRYYDKLPAASRQEMVDQFIALPSNDLINVRSSTFHYKGN
VLLIGDAAHATAPFLGQGMNMALEDTHIFATLLEKHGNALAPTLSEFTHLRKVQADAMQD
MAIANYEALSNPNLIFFLQTRYNRYMHQKFPRIYPPDMADKLFFTSIPYDELQQIQKKQN
VWYKLGRVN
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgcataaaatcattatcgtcggcggaggcctggcaggtagcctcagcgccatttatctg
gcgcaacggggacacgatgtccacgtcgtcgaaaaacgcggcgatccgctgcagaaagcg
tccgccaacgccgatccggtcaactcgcgcgccatcggcgtcaccatgaccgtgcgcggc
gtcaaggcggtgctggcggccggcatcagccggcaggagctcgagctgtgcggcgaacgc
atcctgggcatggcgttttccgtcggccgcacattcaaggtgcgcgaactgccccagcgc
gaaggcttgtttccgctgtcgctggacaggtccgcattccagcgcctgttgaacacctac
gccgccaggcacgaagtgaaatactacttcgagcataaatgcctggatgtcgacctggaa
agaaaagtcgtgctggtccagggcccggacggcgccctgcagcacctgcatggcgacctg
atcatcggtgccgacggcgcccattccgccgtgcgtcgcgccatgcaaagcggcatgcgg
cgctttgaattcaagcaaagcttcttccgccatggctacaagaccctcgtgttgccgaat
gcggagggcctgggtttcaggaaagatttgctgtatttcttcggcatggcgtccaagggc
cagtttgccggccgcgccgccaccatcccggatggcagcgtcagcttcgtcatttgcctg
ccctactccggcacgcccagcctgaacacgctgaaccgggaaaccatggcggccttcttc
gaccgctattacgacaagctgccggcggccagccggcaagagatggtggaccagtttatc
gccctgcccagcaacgacctcatcaatgtccgctcgagcaccttccattacaagggcaat
gtcttgctgatcggcgatgcggcgcacgccaccgctcccttcctcggacagggcatgaac
atggcgctggaggacacgcatatcttcgccaccttgctggaaaagcacggcaatgccctg
gcccccaccctgtccgagttcacgcacctgcgcaaggtacaggcggacgccatgcaggat
atggcgatcgccaactacgaggcgctgagcaaccccaacctgattttcttcctgcagacg
cgctacaaccgctacatgcaccagaaattcccccgtatttatccacccgacatggcggat
aaattgttctttacatcgataccttacgatgaattgcagcaaatccagaaaaagcaaaac
gtttggtacaaacttgggagggtaaactaa

DBGET integrated database retrieval system